KEGG   Myceliophthora thermophila: MYCTH_2304458Help
Entry
MYCTH_2304458     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
mtm  Myceliophthora thermophila
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCTH_2304458
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     MYCTH_2304458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(2401974..2402163,2402304..2403037,2403134..2403580)
Genome map
AA seq 456 aa AA seqDB search
MAGGSEPFPPLSAAADRQFQSTATDNSAPRRRRKSSILGSELRVGDTGAPSIATGIAQLS
GPAKESAASPATTTKRFSKRRKARSALRRAKSIAVKHTWVLPLVILLVFLFLYAINPTEA
NPIHHFIFLSYKLPTSSPDEPPQYGKGPWDIALVSFYTVVLSFTREFIMQEILRPMARWA
GLRSRGKQARFMEQMYTALYFGLLGPTGMYVMSRTPVWYFDTRGMYENFPHKTHDAIFKF
YYLFQAAYWAQQAIVLLLGMEKPRKDFKELVGHHIVSLVLIALSYRFHFTYMGLAVYITH
DISDFFLATSKILNYLDHWLTGPYYFMFMCVWIYLRHYLNLRILFSLFTEFKTVGPYELN
WETQQYKCTISFVITLALLSALQALNLFWLFFIFRIAYRFVVHNIAKDDRSDAEESDVDE
APAPLAANGSANGDVKSSAAAAAAAPTANGAAKKRK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggctccgagccatttccgccgctcagcgcggcagccgatcgccaattccaa
tccacggctaccgacaatagcgcaccccgtcgccgcagaaagtccagcattcttgggagc
gagttacgcgtcggagacacgggcgcgccctcgatagcgaccggcattgcccagctcagt
ggtcctgcaaaggaatccgcagcaagccccgcgacaactacgaaacgcttctcgaagcgc
cggaaagctcgctccgccctgcgccgcgcaaagagcatcgccgtcaagcacacgtgggtg
ctgccactggtcatcctgctcgtcttcctcttcctctacgccatcaacccgaccgaggcg
aacccgatccaccacttcatcttcctctcgtacaagctgcccacttcgagcccggacgag
ccccctcagtatggaaagggcccctgggacatcgccctggtctccttctacaccgtcgtc
ctgtccttcacccgcgagttcatcatgcaggagatcctgcggcccatggcccgctgggcc
gggctgaggtcgcgcggcaagcaggcccgcttcatggagcagatgtacaccgctctctac
ttcggcctcctgggtcccacgggcatgtacgtcatgagccgcacccccgtgtggtacttc
gacacgcgcggcatgtacgagaactttccccacaagacccacgacgccatcttcaagttc
tactacctcttccaggccgcctactgggcccagcaggccatcgtgctgctgctcggcatg
gagaagccgcgcaaggacttcaaggagctcgtcggccaccacatcgtcagcctcgtcctc
atcgccctgagctaccgcttccacttcacctacatgggcctggccgtgtacatcactcac
gacatctctgacttcttccttgccacctccaaaattctaaactacctcgaccactggctc
acgggcccctactacttcatgttcatgtgcgtgtggatctacctgcgccactacctcaac
ctgcgcatcctcttcagcctcttcaccgagttcaagacggtcggcccctacgagctcaac
tgggagacccagcagtacaagtgcaccatctccttcgtcatcaccctggccctgctcagc
gccctgcaggccctcaacctgttctggctcttcttcatcttccgcatcgcctaccgcttc
gtcgtgcacaacatcgccaaggacgaccgcagcgacgccgaggagtccgacgtcgacgag
gcccccgccccccttgctgcgaacggctcggcgaacggcgatgtcaagagttccgccgcc
gccgccgccgccgctccgaccgcgaacggggcggcaaagaagcgcaagtaa

DBGET integrated database retrieval system