KEGG   Myceliophthora thermophila: MYCTH_2304549Help
Entry
MYCTH_2304549     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCTH_2304549
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCTH_2304549
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_2304549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(2546979..2546981,2547090..2548407,2548522..2549069)
Genome map
AA seq 622 aa AA seqDB search
MSPRSERTPLLADSPRNSEESTRAAEEEDAALHGGNAAATLSSSNEHRRGVREVLLFVWA
VIATAGVIVLAVILQHRNATSGTPSPISPSDPSAGGPYTATTTTTTTTTTTTTTTTTTNT
DTNAGLHSKKRNLIFMVSDGMGPASLSLTRSFRQHVQSLPASDVLTLDAHFWGTSRTRST
NSLVTDSAAGATAFSCGRKSYNGAIAMLDGHRPCGTVLEAAKRKGFRTGLVVTTDVTDAT
PASFAAHVDVRWQMDEIALHEVGAGPLGRSVDLILGGGRCHFLGNGTRGSCRNDDVDVLG
LARDRFGWAFKGDRQGFDELQLGRNATLPLLGLFADADVPFEIDRRNMADVYPSLSEMAT
TALTVLDEATKHADHGFFLMIEGSRIDHAGHFNDPAAQVREVLEYDKTFKIVLDYLAKSD
TEGVLVATSDHETGGLSTAWQAPGEAPVYDWYPAVLAKANASAEHLTRLLNEHVAANPGE
SEQSLKDWINKELVVGRLGITDALETELAALAADPAGANPVFCRIVSTRAHIGWSTHGHS
AVDVNIYSSGGPAAEKIRGNVENTDIGKFLSEYLDVDVDAITKELEGKFAARRGGADATA
ETKTGAAAEGFALLSGHRPAAQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgaggtcggagcgcacgccgctcctggccgacagccctcgcaactcggaggag
tcgactcgcgccgccgaagaagaagatgctgccctgcatgggggcaacgccgccgcgacc
ctctcctcgtctaatgaacaccgccgcggcgtgcgggaggtgctcctcttcgtctgggcc
gtcatcgccaccgccggcgtcatcgtcctcgccgtgatcctccagcaccgcaacgcaact
tcgggcacgccctcgccgatctctcccagcgacccctccgccggcggaccctacaccgcg
acgacgacgacgacgacgacgaccaccaccaccaccaccaccaccaccaccaccaacacc
gacacgaatgccggactccactccaagaaacgcaacctcatcttcatggtctcggacggg
atgggcccggcgtcgctgagcctgacgcgctccttccggcagcacgtccagtccctgccc
gcgtcggacgtgctcacgctcgacgcccacttctggggcacgtcgcggacccggtcgacc
aactcgctcgtcacggactcggccgcgggcgcgacggccttctcgtgtggccgcaagagc
tacaacggcgccatcgccatgctcgacggccaccgcccctgcggcaccgtcctcgaggcc
gccaagcgcaagggcttccggaccggcctggtcgtcaccaccgacgtgaccgacgccacc
ccggcctccttcgccgcccacgtcgacgtgcgctggcagatggacgagatcgcgctgcac
gaggtcggcgccggcccgctcggccgctccgtcgacctcatcctgggcggcggccggtgc
cacttcctcggcaacggcacgcgcgggagctgccggaacgacgacgtcgacgtcctcggc
ctcgcccgcgaccggttcggctgggccttcaagggcgaccgccaagggttcgacgagctg
cagctcggcaggaacgcgaccctgccgctgctcggcctcttcgccgacgccgacgtcccc
ttcgagatcgaccgccgcaacatggccgacgtctacccgagcctgagcgagatggccacc
acggccctgacggtgctcgacgaggcgaccaagcacgccgaccacggcttcttcctcatg
atcgagggcagccgcatcgaccacgccggccacttcaacgaccccgccgcccaggtcagg
gaggtgctcgagtacgacaagacgttcaagatcgtgctcgactatctggccaagtcggac
accgagggtgtcctggtggccaccagcgaccacgagaccggcggtctatctaccgcttgg
caagcccctggcgaggcccccgtctacgactggtacccggccgtgctggccaaggccaac
gcctcggccgagcacctcacacggctcctcaacgagcacgtggccgcgaacccgggcgag
tcagagcagtcgctcaaggattggatcaacaaggagctggtcgtgggccgcctcggcatc
acggacgccctcgagacggagctcgccgccctcgcggccgacccggccggcgccaacccg
gtcttctgccgcatcgtcagcacccgcgcccacatcggctggagcacccacggccacagc
gccgtcgacgtcaacatctacagctccggcggcccggccgccgagaagatccgcggcaac
gtcgagaacaccgacattggcaagttcctcagcgagtacctcgacgtcgacgtcgacgcc
attaccaaggagctcgagggcaagtttgccgcccggcgcggtggtgccgacgccacggcc
gagaccaaaaccggcgccgcggccgagggttttgccctgttgagcgggcatcgccccgcg
gcccagtga

DBGET integrated database retrieval system