KEGG   Myceliophthora thermophila: MYCTH_2304605Help
Entry
MYCTH_2304605     CDS       T02231                                 

Definition
histone H3-K79 methyltransferase-like protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
mtm  Myceliophthora thermophila
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MYCTH_2304605
Enzymes [BR:mtm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MYCTH_2304605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(2648741..2649330,2649392..2650304)
Genome map
AA seq 500 aa AA seqDB search
MSILNKKSKFKVKTEVRKVQQAVAPKPATNAPGASSSSSTSVSLRGTPRASPVPASSLSV
KRLQQQPASSPSHSSPAPAPSTGNPNRKRPALVSRRSTASASPAPILSDSEPGSEDDDDW
RERLDPSKRRKRAHTEDPGRRLRHPKLWAGDGDDEIPAIVHSAEVASLENKCQPVMRLGR
DEVVVHLRYPGARSMERYELVWGKDKIDGAADIMKVVHIAASTYLTDTEAKPFLDHDTGI
YRRLEKSKNTNDGNGFKAALADYNDRLLELQKKGAIAKNIDAMRGVPRELVEVILGQIYD
RTVAPKVELLAKYENGTDNVYGELLHPFISDIFDRTKLSSDMVFVDLGSGVGNVTLQAAL
ERGCESWGCEMMENACNLAEAQKKEFAARCRLWGIAPGKVYLERGDFRKNERTLEALKRA
DVVLVNNQAFTSQLNDHLVNMFLDLKIGCKIVSLKTFVHDNKIAENDVASSILEVEHLSY
PGGYVSWTGAPGRYCISTRK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattgaacaaaaaatccaagttcaaagtcaagaccgaggtgcgcaaggtccag
caagccgtcgcgcccaagccagccacgaacgcccccggcgccagcagcagtagcagcacc
agcgtgagccttcggggcacgccccgcgcttcgcccgtcccggcctcgtccctgagcgta
aagcgactccagcagcagcctgcgtcctccccctcacattcttccccagcgcctgccccc
agcaccggcaaccccaaccggaaacgaccagcgctcgtcagcagacgctccaccgcgagc
gcaagccccgcgcccattttgagtgactctgagcccgggtcggaggacgacgatgactgg
cgggagaggttagacccgagcaagcggcggaagcgggcgcacacggaggatccgggccgg
cggttgcggcatccgaaattatgggcgggcgacggtgatgatgagataccggcgattgtg
cactcggcggaagtggcatcgctcgagaataagtgccagccagtcatgagattggggagg
gacgaagttgtagtacacctgcggtatcccggggctaggtccatggagcggtacgagctc
gtatggggcaaggataagattgacggcgccgcggatatcatgaaggtggtccatattgcg
gcatcgacgtacctcacggacaccgaggcaaagccgtttctggatcatgacaccggaatc
tatcgccggctggaaaagagcaagaacaccaatgatgggaacgggtttaaggcggccttg
gcggactacaacgaccggctcctcgagttgcaaaagaaaggagcgatagcgaagaatatc
gacgccatgcgcggcgtaccccgggaactcgtcgaggtcatcttgggccaaatatacgac
cgcacggtggcgcctaaagtcgagttgctcgccaagtacgaaaacggcaccgacaacgtt
tatggcgagctgctccacccctttatctccgatatctttgaccggacgaagctgagctct
gacatggtcttcgttgacctcggttccggagtcggcaacgtgacgcttcaggcggctcta
gagagagggtgcgagagctggggttgcgagatgatggagaacgcgtgtaacctggccgag
gcgcagaagaaagaattcgcggcgcggtgtcgtctgtggggtattgcgccaggcaaggtg
tacctcgaacggggcgactttcgtaagaatgagaggactctggaggcgctcaaacgagcg
gacgtggtcttggtcaacaaccaggctttcacgtcgcagctcaacgaccacctcgtcaat
atgttcttggacctcaagatcggatgcaagatcgtgtcgctcaagacgttcgtccacgac
aacaagattgccgaaaacgatgttgcgtcgtcgatcttggaagtcgagcacctgagctac
cctggaggctacgttagctggacaggagctccaggtagatactgtatttcgacgaggaaa
tga

DBGET integrated database retrieval system