KEGG   Myceliophthora thermophila: MYCTH_2304715Help
Entry
MYCTH_2304715     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCTH_2304715
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2304715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(2971964..2972913,2972997..2973726,2973807..2974152,2974216..2976622,2976710..2976887))
Genome map
AA seq 1536 aa AA seqDB search
MEPEQNVAEGREDVDMLTITESQRTETADGPKEEQGNQEETEAPENPPPDKQAELPLRND
IPPLDQQIKTIETLVQAFAETPVKEGDEAYLVSRKWLAKAQACRSDAKHASKESSDGSPG
PVDNSDIIQAIFTDSTGERCVKLKPGTGIEDFELFPKDAWDLLLSWYGLAAGQSPIVRVA
HNTAPDSVSIPTIQFEFHPPVFTIHRMWSANSPIPIEQEVKLKKPAPPVIVQSTSSSYHK
FLKQAKKLVGVAPDRKVRVWRLLQTIPATEPTSEPSGIKTPPDSPGRGHGVLTQAPSTPG
AWPEMLVDVATFLTLEKDVERGLVDSEDTTTNPNYNGRKNLALVGLAVDQTLVLDEQIDR
DAFVSNYRGGTVKDRALAARSSSTGLVAQRGNASGRSSPAPQGALTRGRAQQKPGRTLGC
VGLQNLGNTCYMNSALQCVRSVEELTKYFLTHEAQKEINPDNPLSHNGEVAAAYGRLLEE
IYRDPAPGSIAPRHFKAVIGRYASAFSGYGQQDSQEFLGFLLDGLQEDLNRIKKKPYIEK
PDSTDDMINNPEAVREMAAKVWDITKKRDDSVIADLFTGMYKSTLVCPVCDKVSITFDPF
NNLTLPLPVANVWSRSVKFFPLNDVPVEIVVDLDKNSSIRALKQYIAVRVGVPAERLFAG
EEFHSKFFKFYDDGSAVSDEIQSSDVAVVHEIEAAPTNVYGPKKQLALNGRLASPSQDED
DSSPVEDPRLERMLVPVLHRIDPSDPSARKRYVRKSDTALPPPHFIVLTPEEARDLEAIR
RKILEKVATFTTWSKLSAPEDTDVAEGTDSEMVNTTVSDADSAGDSKVVAKSVEGEDDMV
DVTMRDASDARNNTSAATPVEETPKVLKRFNKRRPKWVNPVEFLDPELQNLFDMSYFYES
GTTVPTGWTSTTDEGVLPRLSSRLPRVAASDIEMQSPATLDGSDESGSEGSGRLPATVVT
RMAEESSDEDSEFTRHKNFHSRPGNQFNGRKRGGKHKTYGKGKGRFNKQNRLSRGKQPAA
QPAAVEMPEESLPTGALVGLGEGIVVEWSEAAFDLVFGGATPDEMRGMKTYLKVPTLEDP
GLQAKQKARQLRKKHGIALDDCLDEFEKEEILSEQDTWYCPRCKEHRRASKKFDLWKTPD
ILIVHLKRFSSSGWRRDKLDILVDFPVEGLDLTKRVINKEEGKEEVFDLIAVDDHWGGLG
GGHYTAFAKNFIDGEWYEYNDSSVSKQKDTSRVVTSAAYLLFYRRRSKVPLGGPRFQEIS
DRFNQSALRDDASDSGEGERLGQGSSQRGSPSALTGAGPALLRESRGWDNSGRRAASERP
SYRGGNNDDDADMGTTWSNQDTLHNSIEGDGEDEGIGLSDYDTAGMAGMTSIIGPTSWSF
GNLVEGSKPGSEVGGGDDIASDIAQNDGSSVQGDMTDVFDDASGMEHLLSRDPEADYVGP
PEPTAPVVGFVGDDEYGIPPPPSAADQELIGKLAEQAWVDGEVHKVPPVGDLGVIEDDQA
SDKVAEIHVDDPEMEDQTTAAAAATAAAAPEGKSPA
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagagcagaacgttgcggaagggagggaggacgtggatatgctcacaatcacg
gaatctcaaaggacagaaacggcagatgggccgaaagaagagcagggcaaccaggaggag
actgaggccccagaaaatcctccgcccgacaaacaggcagagctgcccttacgaaatgac
atcccgccgctcgaccaacaaatcaagacgatcgagaccctcgtgcaggcctttgctgag
acccccgtgaaggagggcgacgaggcatatctcgtgtctcggaaatggctcgccaaagct
caggcatgtcgttcggatgcaaagcacgccagcaaggaatcctcagacgggtcacccggg
ccggtcgacaactcggatatcatccaagccatcttcacagactccaccggcgagcgctgc
gtcaagctgaaacccggcacgggcattgaggatttcgagctctttccaaaggacgcgtgg
gatctcctcctttcgtggtacggcttggctgccggccagtcgcccattgtccgggtcgca
cacaacacggcaccagactccgtgagcatcccgaccattcagttcgagttccatcctccg
gtgttcaccatccaccggatgtggtctgcgaacagtcccattccgattgaacaggaagtc
aagctcaagaagcctgcgccccccgtcatagtccaaagcacatcctctagttaccacaaa
ttcttgaagcaggccaagaagcttgttggcgtggctcccgacaggaaagttcgcgtgtgg
aggctgctccagaccattccagccacagagcccacctcggagccgtcggggatcaagacg
ccgccagattcacccggccgtggtcacggagttctcactcaggctccatctacccccggc
gcctggcccgaaatgcttgtcgacgtggcaacgttcttgaccctggagaaggacgtcgaa
cgcggcctggttgacagcgaggacaccactactaatcctaactacaacggaaggaagaac
ctggcgttagtaggccttgctgttgaccagacgcttgttctggatgagcagattgatcgt
gacgccttcgtctccaactatcgaggcggcaccgtcaaggatagagctctagcggcccga
agcagctcgacaggcctcgtggcgcaacgcggtaatgccagcggacgcagcagtcccgca
cctcagggggccctcacaaggggccgggcgcagcaaaagccagggcgcaccttgggctgc
gtcggtttgcagaatctgggcaacacgtgctacatgaactcggcgctgcaatgtgtgcgg
agcgtcgaagagctcacaaaatacttcctcacacacgaagcgcagaaggagatcaacccg
gacaacccgctctctcacaatggcgaggttgctgccgcctatgggcgcctgctggaggag
atctacagggaccctgctcccggctccatcgccccacgccatttcaaagctgtcatcggg
cggtatgcgtcggccttttccggatacggccagcaggactctcaggagttcctcggtttt
ctcctcgacgggcttcaagaggacttgaaccgcatcaagaagaagccctacatcgagaag
cccgactccacagacgatatgatcaacaatccggaggcggtccgcgagatggcagccaag
gtctgggacatcaccaagaagagagacgactcggtcattgccgatctcttcaccggcatg
tacaagtctaccctggtgtgtcccgtctgtgacaaagtcagcatcacttttgaccctttc
aacaaccttaccctaccgcttccggtggccaatgtctggtctcgtagcgtcaagttcttt
cccctaaacgatgtgcccgtcgagattgttgtcgacctcgacaagaacagtagtatcagg
gctctgaagcagtacattgccgtgcgggtcggggtgcccgctgagcgcctctttgcgggc
gaagagtttcactccaagttcttcaagttctacgatgacgggtccgcagtctctgacgag
atccagtcgagcgatgtcgccgtcgtgcacgagatcgaggcagcccctactaatgtttac
ggccccaagaaacagctggcgctcaacggccggctggcgtcaccgtcgcaagacgaggac
gattcctctccggtcgaggatccccgactggagcgcatgctcgtcccagtcctgcaccgc
atcgatccctcggatccttcggccaggaagcgttatgtgcgcaagagcgacaccgccctt
cctccgccgcacttcatcgtcctaacgccggaggaggcgcgtgacttggaggccatccgc
cgcaagatcctggagaaggtcgccaccttcacgacttggtccaagctgtcggctcccgag
gacacggatgtggccgagggcacggactcggagatggtgaacacgactgtgtccgatgca
gattccgcgggcgattccaaggtcgttgccaagtcggtggaaggagaggacgacatggtc
gacgttactatgcgtgacgcctctgatgcgcgtaacaacacctccgccgctacgcccgtc
gaagagacaccaaaggttctgaaacgtttcaataagaggcggcccaagtgggttaaccct
gtcgagttcttggatcccgagctgcaaaatctgtttgacatgagctacttctacgagtcg
ggcacaaccgtccccaccggctggacttccactacggatgaaggcgttttgccgcggctg
agctccaggctgcctagggtggccgcctcggacatcgagatgcagagccccgcaaccctg
gatggttccgacgagagtggcagcgagggatccggtagactgccggccactgttgtcact
cgcatggccgaggagtctagcgacgaggactcggagttcacgaggcacaagaacttccac
tcacggccaggcaatcaatttaacggccgcaagagaggtgggaagcacaagacttacgga
aagggtaagggccgtttcaacaagcaaaatcgactttcccgcggcaagcagccggcggcg
cagccggcggccgtcgagatgcccgaagagtcccttcccacgggcgctctggtcggcctg
ggcgagggtatcgtagtcgagtggagcgaggctgcctttgacctcgtcttcggtggcgca
acgcccgatgagatgcggggtatgaaaacgtatctcaaggttccgacgttggaagacccc
ggcctgcaggcaaagcagaaagcgcggcagttgcgtaagaagcatggtatcgccctcgac
gactgcctggacgagttcgagaaggaagagattctctcggaacaggacacgtggtactgt
cctcgctgcaaggagcatcgccgtgcgagcaagaagttcgacctctggaagacaccggat
atcctcattgtccacctcaagcgtttcagttctagcgggtggaggcgggacaagctggac
attctcgtcgacttccccgtggagggtctcgatctcacaaagcgcgtcatcaataaagag
gagggaaaggaggaagttttcgacttgatcgccgtggacgaccattggggcggcctaggc
ggcggccactacacggcctttgccaagaattttatcgacggcgagtggtacgagtacaat
gattcttcggtcagtaaacagaaagacacctctcgcgtggttacctcggcagcgtatctc
ctgttctaccgtcgccgctccaaggtccccttgggcggtcccaggttccaggagatctcc
gaccgtttcaaccagtccgccctccgtgatgacgcgtcggattcgggggaaggcgagcgt
ctcggccaaggctcctcccagcgtggatcgccgagcgctttgaccggagccggtccagct
ctccttcgggaaagtcgtggttgggataatagtggtagacgtgctgcgtcggagcggccg
tcgtaccggggcggcaacaacgacgacgacgccgacatgggtacgacctggagtaaccag
gacactctgcacaacagcattgagggtgacggcgaggatgaagggatcggcctgtcagac
tacgacaccgcgggtatggcgggcatgacctccatcattgggcctaccagttggagtttc
ggcaatctcgtcgagggcagcaagcccggttccgaggttggcggtggcgacgacattgcc
agcgacattgcgcagaatgacggatcgtcggtccaaggcgacatgaccgacgtgttcgac
gatgcttcggggatggagcacctgctctcgcgggatcccgaagccgactatgttggcccg
cccgagccgacagcgccggttgtcgggtttgtgggcgacgacgagtacggcatcccgccg
ccgccgtcggcagcggaccaagagttgatcggcaagcttgccgagcaggcgtgggtcgat
ggagaggtccacaaagtccctcctgtgggtgatctcggcgtgatcgaagacgatcaggcg
agcgacaaggttgccgagatccatgtcgacgatccggagatggaagaccaaacgacggcg
gctgctgctgctactgctgctgctgcgccggagggtaagtcgcccgcttag

DBGET integrated database retrieval system