KEGG   Myceliophthora thermophila: MYCTH_2304931Help
Entry
MYCTH_2304931     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mtm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mtm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mtm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mtm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(3262925..3262953,3263007..3263621,3263743..3263813,3263899..3263936))
Genome map
AA seq 250 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKTIVKGLNEAQLDSNVEVVIAPPAIYLHLAQSELKKPGIE
VSAQNVYDKPNGAYTGEISVSQLKDSGVNWTILGHSERRTLLGETDEVVASKTKFAVDGG
VSVIWCCGESLQERESGNTVAVVERQLAALAAKLSTDDWKKVVIAYEPIWAIGTGKVATV
EQAQEVHEAIRKWLKANVSDAVAEETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLKP
EFVDIINSNL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggcggcaacttcaaaatgaacgggaccaaggagtccatc
aagacaatcgtaaagggtctcaacgaggcgcaattggactccaatgttgaggtcgtgatc
gctcctccggccatctacctacacctcgcccagagcgagctcaagaagcccggcatcgag
gtgtctgcgcagaacgtctacgacaagcccaacggcgcctacacgggcgagattagcgtg
tcgcagctcaaggacagcggcgtcaactggaccatcctgggccattcggagcgccggacg
ctgctcggcgagaccgacgaggtggtggcctccaagaccaagttcgctgttgacggcggc
gtcagtgtcatctggtgctgcggcgagtcgctccaggagcgcgagagcggtaacacggtc
gccgtcgtcgagcgccagctggccgccctggccgccaagctctcgaccgacgactggaag
aaggtcgtgattgcgtacgagcccatctgggccatcggcaccggcaaggttgccaccgtt
gagcaggcccaggaggtgcacgaggccatccgcaaatggctcaaggccaacgtcagcgac
gccgtcgccgaggagacgagaattctgtacggcggcagcgtcaacggcaagaactgcaag
gacctggccaaggagaaggacattgacggcttcctggtcggcggtgccagcctgaagccc
gagttcgtcgacattatcaactccaacctctga

DBGET integrated database retrieval system