KEGG   Myceliophthora thermophila: MYCTH_2304931Help
Entry
MYCTH_2304931     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYCTH_2304931
   01230 Biosynthesis of amino acids
    MYCTH_2304931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2304931
   00051 Fructose and mannose metabolism
    MYCTH_2304931
   00562 Inositol phosphate metabolism
    MYCTH_2304931
Enzymes [BR:mtm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYCTH_2304931
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYCTH_2304931
  Exosomal proteins of bladder cancer cells
   MYCTH_2304931
  Exosomal proteins of melanoma cells
   MYCTH_2304931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(3262925..3262953,3263007..3263621,3263743..3263813,3263899..3263936))
Genome map
AA seq 250 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKTIVKGLNEAQLDSNVEVVIAPPAIYLHLAQSELKKPGIE
VSAQNVYDKPNGAYTGEISVSQLKDSGVNWTILGHSERRTLLGETDEVVASKTKFAVDGG
VSVIWCCGESLQERESGNTVAVVERQLAALAAKLSTDDWKKVVIAYEPIWAIGTGKVATV
EQAQEVHEAIRKWLKANVSDAVAEETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLKP
EFVDIINSNL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggcggcaacttcaaaatgaacgggaccaaggagtccatc
aagacaatcgtaaagggtctcaacgaggcgcaattggactccaatgttgaggtcgtgatc
gctcctccggccatctacctacacctcgcccagagcgagctcaagaagcccggcatcgag
gtgtctgcgcagaacgtctacgacaagcccaacggcgcctacacgggcgagattagcgtg
tcgcagctcaaggacagcggcgtcaactggaccatcctgggccattcggagcgccggacg
ctgctcggcgagaccgacgaggtggtggcctccaagaccaagttcgctgttgacggcggc
gtcagtgtcatctggtgctgcggcgagtcgctccaggagcgcgagagcggtaacacggtc
gccgtcgtcgagcgccagctggccgccctggccgccaagctctcgaccgacgactggaag
aaggtcgtgattgcgtacgagcccatctgggccatcggcaccggcaaggttgccaccgtt
gagcaggcccaggaggtgcacgaggccatccgcaaatggctcaaggccaacgtcagcgac
gccgtcgccgaggagacgagaattctgtacggcggcagcgtcaacggcaagaactgcaag
gacctggccaaggagaaggacattgacggcttcctggtcggcggtgccagcctgaagccc
gagttcgtcgacattatcaactccaacctctga

DBGET integrated database retrieval system