KEGG   Thermothelomyces thermophila: MYCTH_2304931Help
Entry
MYCTH_2304931     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00010  Glycolysis / Gluconeogenesis
mtm00051  Fructose and mannose metabolism
mtm00562  Inositol phosphate metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01200  Carbon metabolism
mtm01230  Biosynthesis of amino acids
Module
mtm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtm_M00002  Glycolysis, core module involving three-carbon compounds
mtm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_2304931
   00051 Fructose and mannose metabolism
    MYCTH_2304931
   00562 Inositol phosphate metabolism
    MYCTH_2304931
Enzymes [BR:mtm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MYCTH_2304931
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MYCTH_2304931
  Exosomal proteins of bladder cancer cells
   MYCTH_2304931
  Exosomal proteins of melanoma cells
   MYCTH_2304931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-GeneID: 11507874
NCBI-ProteinID: XP_003663248
JGI: 2304931
UniProt: G2QBR0
Position
3:complement(join(3262925..3262953,3263007..3263621,3263743..3263813,3263899..3263936))
Genome map
AA seq 250 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKTIVKGLNEAQLDSNVEVVIAPPAIYLHLAQSELKKPGIE
VSAQNVYDKPNGAYTGEISVSQLKDSGVNWTILGHSERRTLLGETDEVVASKTKFAVDGG
VSVIWCCGESLQERESGNTVAVVERQLAALAAKLSTDDWKKVVIAYEPIWAIGTGKVATV
EQAQEVHEAIRKWLKANVSDAVAEETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLKP
EFVDIINSNL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgtcggcggcaacttcaaaatgaacgggaccaaggagtccatc
aagacaatcgtaaagggtctcaacgaggcgcaattggactccaatgttgaggtcgtgatc
gctcctccggccatctacctacacctcgcccagagcgagctcaagaagcccggcatcgag
gtgtctgcgcagaacgtctacgacaagcccaacggcgcctacacgggcgagattagcgtg
tcgcagctcaaggacagcggcgtcaactggaccatcctgggccattcggagcgccggacg
ctgctcggcgagaccgacgaggtggtggcctccaagaccaagttcgctgttgacggcggc
gtcagtgtcatctggtgctgcggcgagtcgctccaggagcgcgagagcggtaacacggtc
gccgtcgtcgagcgccagctggccgccctggccgccaagctctcgaccgacgactggaag
aaggtcgtgattgcgtacgagcccatctgggccatcggcaccggcaaggttgccaccgtt
gagcaggcccaggaggtgcacgaggccatccgcaaatggctcaaggccaacgtcagcgac
gccgtcgccgaggagacgagaattctgtacggcggcagcgtcaacggcaagaactgcaag
gacctggccaaggagaaggacattgacggcttcctggtcggcggtgccagcctgaagccc
gagttcgtcgacattatcaactccaacctctga

DBGET integrated database retrieval system