KEGG   Myceliophthora thermophila: MYCTH_2304994Help
Entry
MYCTH_2304994     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCTH_2304994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(3359872..3359931,3360038..3364368,3364428..3365057,3365134..3365317))
Genome map
AA seq 1734 aa AA seqDB search
MSELRALEALQALHGELVAVRQHRYEGLPVLEQLLDAQADAFKKLIDKPPRNSAHRQSLG
TGKVKIDEDEYAINDDFVNDCLKVADDLDLDELEAARILLDCDAEGDTETQSRPLWECAV
IRFHQERRYLLDCMRLICEIAADDELEPELQDSFGAIAEEKVFGIPPPGSRAGEAVKKAV
PRFMEAMQSVRSMLHSMMEKATGRSLLQQADLVRAPENQETFDFSRASLVEQHECLAAIL
HAAVEKRHATVKDFQDFIETLRRVDKYDHFLVHLFPVLAAYISAFGSTEGVSDLQQARQL
NGVVIKPTDDAWALPHLGAAVRAWWIAEYSEWYLDDTIYDFQGINLDEEDEERNKQFMEA
LKEGAFDFILAVAADCRAQEWQDPSRLGMRQWLQRKSPPLASDPFPFSHFLQRSLMVHLE
EFVDACISNLPDMLRKLRTQEDEQRQLSQNHEQDFDLERFLIIVSYAYEGRPDAAMSFWE
DPDSNLAGFLHWASRRASTPLVSAFCEMLQCLSDSEECATAAHMFLLDEGHQSSGKMKRS
QSLTWSQIFKELDYFTRQLRDKPAPAQAQVMQRPSKPGADLAETEPESALMLECYLRLIA
KLTTESAVARQRMLMDEEMRLVDTLFRLGDGPLPARLRACIFYVLKALMTQKQVPESEAL
WRYVDAWATNTLPNPGAQQRVTYLGQPLTPEGHMEAILNDLSGGFEESNAFIQLLASLFA
PLDGPEGLNDSLTFPEDLGSNIRAPGMEPYVDFVFRVFSQKSQELADPGQLRALRLSCLE
FALTCLSTFNEDLIILGNESNIAIDVAMPTTDLATYVRLHPFARVMEWLFNEKVVNALIR
TIHQDPVSLGSASPDSPLVLSILRGIQVMIKALDLQETYLHLVRPLVQSEKQRRASVANA
AYSSFEDGILSHLGLVVDLGKYCNLGHGELTLACLKLLEKISTSPRIISAWNPDTGRLGH
RNKAIVQLEKDGEGHTIAASLAANISAPLDPALEAESENYVIKLFILDFIYECLKATPDQ
PTIAHLLLGFHCELNRLTIEPRGAFDAQKSLFHSLLNIAIEISVYEEEHGMRGYLITLKY
RILRILQILWKSPLSATLVMDELRATNFLFHMLLREIQIQPDLRWDDLQADNPEFLLSNA
SVAYIDYLGARAMIFEYIGKELCSVSQNRIPSVKRQIFDALNGTIKMDNQEPLSLANIFD
FFDFLNPDANWDVPPPQFVFYKDLDIRPSAVEHPEAGLQYNIHKVRETIALKRNEFRDSF
QVMTPQHLDAIETEERVLVEYLTFTNRQKLFGAARLTLLRAWANLLLVMFEANDFKGTHK
MAFLLQALQAILPTLEAYSTLSHAEAFELARVAKVLLFKLDLDDDDDSSGSAVERERFAI
GNLISDKLFQLFQVCLSSISKWAGSAELRSLYYGICYRYLTAVVDRDATAAPGPRSRGLA
TARARTLKAIQLHGDRLLNVICDDAYGSDITCQTAATVLLSALVHTSRRSDDDVTIIESL
NRLNFLGVLVDSLKTILTDWLSVISPPANSGPPNSATQQQTEQYLSAKLALLLQIAQTRP
GAKYILQANLFRALEIAGVFAADPELQVDARDTRALEKHYTLLVALARIVGAAVLARGAH
NVVQGRRFLTQHRMLVVHTLKRSAGIGMGIGGGGGGGGQWQGQGNGTSLFGGSVVARGGG
GGGQDDAEAQAALEERIDELAEAFMLLITATDFLEYEAGQVPAEKPRVAPTLFH
NT seq 5205 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactgcgcgcactcgaggcccttcaagccctgcacggggagctggtcgctgtc
cgccagcaccggtacgagggcctgccggtcctggaacagctcctggacgcgcaagccgac
gcgttcaaaaagctgatcgacaagcctccgcgaaactcagcccacagacaatccctaggg
actgggaaggtcaagattgacgaagacgagtacgcgatcaacgatgacttcgtcaatgac
tgcctcaaggttgccgacgacctggacctggacgaactggaggcggcgaggattctgctg
gactgcgatgccgaaggcgacaccgagacgcaaagccgtccgttgtgggaatgcgccgtc
attcgtttccaccaggagcgcaggtaccttctcgactgcatgcgcctcatttgcgagata
gcggccgacgacgagcttgaaccggagctacaggactccttcggcgccattgccgaggag
aaggtgtttggcattccgccacctgggtcaagggcgggggaggctgtgaagaaggctgtg
ccgaggttcatggaggccatgcagagtgtgcggtccatgctgcatagcatgatggagaag
gccacggggcggagcttgctgcagcaggccgacctcgtgcgggcgccggaaaaccaagaa
acgttcgacttctcgcgcgcaagcctcgtggagcagcacgaatgtctggcagcaattcta
cacgccgccgtcgagaaacgtcatgcgaccgtcaaagattttcaagacttcatcgagacc
ctgaggagggttgacaagtacgaccactttctcgtgcacctgttcccagtcctcgcggcg
tatatctcagcgttcggctccaccgagggagtgagcgatctccagcaagcccgccagctg
aacggggtagtcatcaagccgaccgacgacgcctgggcccttccacatcttggcgccgcc
gtccgggcatggtggattgccgagtacagtgaatggtacttggacgacaccatctacgac
tttcaggggatcaacctcgacgaggaagacgaggagaggaacaaacaattcatggaggcg
ctaaaggagggtgccttcgacttcatcttagctgtggctgctgattgtagggcccaggaa
tggcaggacccgtcgcgcctgggaatgcgtcaatggctccagcggaagtctcctcccctg
gcttcggatcccttccccttcagccactttctccagcggagcttgatggtacacttggag
gaattcgtggacgcttgcatctccaaccttccagatatgcttcgaaaactaagaacccag
gaggatgagcagagacagctcagccaaaaccacgagcaagactttgatctcgagcgcttc
ctgataatcgtctcatatgcctacgaagggcgacctgacgcggccatgtctttctgggag
gatccagatagcaacctggccggcttcttgcactgggcgtcaagacgagcatccactccg
cttgtgagcgcgttttgcgaaatgctgcagtgcctctcggacagtgaggaatgtgcaacg
gctgctcacatgtttctgctagacgagggccaccaatcttccggcaagatgaagcgctcc
cagtcattgacgtggtcccaaatcttcaaagagctggattattttacgagacagcttcgt
gataagccagcgccggcacaggcccaggtcatgcaacgccccagtaaacctggagctgac
ttggccgagacggagcccgagtctgcattgatgctggagtgctatttgagactgattgcc
aagctgacaacagagagcgcggttgcccggcagaggatgttgatggacgaggagatgcgg
ctggtcgatacactcttcaggcttggagatggtccactaccggctcggctccgcgcttgc
atcttctacgtcctgaaagccttgatgacgcaaaagcaagtccccgaaagtgaagcgctc
tggagatatgtcgatgcgtgggcaacgaacaccctgcctaacccgggagcccagcaaagg
gtgacatacctcgggcagcctctcaccccggaaggtcacatggaagcaatcttaaacgac
cttagcggtggcttcgaagagtcgaacgcgttcattcagcttctcgcgtccctcttcgcc
cctcttgatggccccgaggggctgaacgacagcctgacgttccccgaggatctggggagt
aacattcgcgcgcctgggatggagccctacgtcgactttgtcttccgcgtcttctcgcag
aagtcccaggagcttgcagatcctggtcagctcagagcgctgcgcctcagctgtctcgaa
ttcgccttgacctgcttgtcgactttcaacgaggacttgatcatcttgggtaatgagagc
aatattgccattgacgtggcgatgccgactaccgatctggccacatacgttcgccttcat
ccgttcgcccgcgtcatggagtggctgttcaacgaaaaggttgtcaacgcccttattcgc
actatccaccaagatcccgtcagtctaggcagcgcatctcccgactcgcctctggttctc
agcattctacggggcatccaagtcatgatcaaggctctcgacctacaggagacttatctg
caccttgtgcgccctctcgttcagtcggagaagcaacgacgcgcttcggtggccaacgcc
gcgtattcctccttcgaggacggtatcttgagccaccttggcttggtggtcgacctgggc
aagtactgcaatctcggccacggtgagttgacccttgcctgtctgaagctgctcgagaag
atctctacgtcccccaggatcatctcggcgtggaacccggataccggccgtcttgggcac
cggaataaagcgatcgtccaacttgagaaggacggggaggggcataccatcgccgcgtcg
ctcgccgcaaatatctctgcccccttggacccggctctggaggccgagtcggaaaattac
gtgatcaagctgtttattctggatttcatctacgagtgcctcaaggcgacgcccgaccag
ccaaccatcgctcacctcctcctcggtttccactgcgagctgaaccggctaaccatcgag
ccgaggggggcgtttgacgctcagaaatcactgttccacagtcttctcaatatcgccatt
gaaatctcggtgtacgaggaggagcacggcatgcgcgggtacctgatcaccttgaagtac
cggatcctgcgcatcttgcagattctctggaagtctccactatctgccactctggttatg
gacgaattgagagccaccaacttcctcttccacatgcttctgagggagatccagatccag
ccggacctgagatgggacgacttgcaggcggacaaccccgagttcctgctctcaaacgcc
tcggtcgcgtatatcgattatcttggggcgcgagccatgatctttgagtacatcggcaaa
gagctgtgcagcgtctcgcagaacaggataccctccgtcaagcgccagatcttcgacgcc
ttgaacggcacgatcaagatggacaaccaggagcctttgagcctcgccaacatctttgat
ttctttgacttcctcaatcccgacgccaactgggacgttccgccgccgcaatttgtcttc
tacaaggacctcgacatcagaccgtccgccgtcgagcatccagaggcggggttacagtat
aacattcacaaagtacgggagaccatcgcgctgaagcggaacgagttcagggactcgttt
caagtaatgaccccgcagcatctggacgccatcgagaccgaagagagagtattggtcgag
tacttgacatttaccaatcgtcagaagctgttcggcgcggcgaggctcaccctgctcagg
gcgtgggccaacctgctcctggtgatgttcgaagccaacgactttaagggcacgcataag
atggcgttcctgctgcaagcactgcaggccatcctgccaaccctcgaggcctacagcacg
ctgagccacgccgaagcattcgagcttgcgcgagttgccaaagtgctcctttttaagctc
gacctcgacgatgatgacgacagctccggctcggcagtggaaagagagagatttgccatt
ggaaacctcatcagcgacaagctcttccagctcttccaggtctgtctcagctccattagc
aagtgggcaggcagtgccgaactccgctcgctgtactatggcatctgctaccgctacctc
accgccgttgtcgacagagacgccacggcggcgccagggcctcgcagccgcggtctcgca
actgcccgtgccagaaccttgaaggcaatccaactccacggcgaccgcctcctcaacgtg
atctgcgacgacgcttacggtagcgatattacctgccaaaccgccgctaccgtcctcctt
tcggcactcgtccacacctcgcggcgctcggacgacgatgtgaccatcatcgaatctctc
aaccgtctcaacttcctcggcgtcctcgtcgactccctgaaaaccatcctcaccgactgg
ctctccgtcatcagcccccccgccaactccggccccccgaattccgccacccaacagcag
accgaacagtacctctccgctaagctcgccctcctcctgcagatcgcccagacgcggccc
ggcgcaaagtacatcctccaagcgaacctgttccgcgccctcgagatcgcaggcgtcttc
gccgcggacccggagctgcaggtcgacgcccgggatacccgcgcgctcgagaagcactac
acgctgctcgtggcgctggcgcgcatcgtcggcgcggcggtgctcgcgcgcggcgcgcac
aacgtggtgcaggggcggcgtttcctgacgcagcaccggatgctggttgtgcatacgctc
aagcggagcgcggggattgggatgggcatcggcggcggcggcggtggcggtggacagtgg
caggggcaggggaatgggaccagcctgtttggcggaagtgtcgtggcgagagggggagga
ggggggggccaggatgacgcggaagcgcaggcggcgctggaggagaggattgacgagctg
gcggaggcattcatgctcctgatcactgcgaccgactttttggagtatgaggcgggccag
gttcctgctgagaagccgagggtggcacccacgcttttccattga

DBGET integrated database retrieval system