KEGG   Myceliophthora thermophila: MYCTH_2305189Help
Entry
MYCTH_2305189     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mtm  Myceliophthora thermophila
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mtm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(3658308..3658457,3658606..3659149,3659235..3659316,3659391..3659544))
Genome map
AA seq 309 aa AA seqDB search
MADSLLARKYFDGIYIPFGLLVVGTVIVKREWTVYAVLLGLALGSWKYYKNLPKAVLKPD
VFQEFELKEKTVISHNVAIYRFALPSPNSILGLPIGQHISIGATLDQPDGTKKEIVRSYT
PISGDDQPGHFDLLIKSYPQGNISKHMAGLAVGQTIRIKGPKGAFVYTPNMVRHFGMIAG
GTGITPMLQVIKAIIRGRAAGDRTEVDLIFANVTEQDILLREDLDQLAAQDKGFRVHYVL
DKPPAGWQGGVGYVTADMIQKWLPKPADDVKILLCGPPPMVSGLKKATESLGFKKARPVS
KLEDQVFAF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggattctctgcttgcgcgaaagtatttcgatggcatctacatccccttcggcctg
ctcgtcgtgggcaccgtcattgtgaagcgcgagtggacggtatacgcggtgctgctcgga
cttgccttgggcagttggaagtactacaaaaacctccccaaggcggtcctcaagcccgat
gtcttccaggagtttgagctcaaggagaagaccgtcatctcgcacaatgtagccatctac
cgcttcgcccttccgtccccgaactcgatcctcggcctccccatcggccagcatatctcg
atcggcgcaactctcgaccaacccgacggcaccaagaaggagatcgtccgctcctacact
ccgatctcgggcgacgaccagccgggccacttcgacctcctcatcaagtcgtacccgcag
ggcaacatctccaagcacatggccgggctcgccgtcggccagacgatccgcatcaagggg
cccaaaggcgccttcgtgtacacgcccaacatggtccggcacttcggcatgatcgccggc
ggcacgggtatcacgcccatgttgcaggtgatcaaggccatcatccgcgggcgcgctgcc
ggcgaccggaccgaggtcgacctgatctttgccaacgtcaccgagcaggacatcctgctg
cgcgaggacctggaccagctggccgcccaggacaagggcttccgcgtccactacgtgctc
gacaagccccccgccggctggcagggcggcgtgggctacgtcacggcggatatgattcag
aaatggctgcctaagcccgctgatgacgtcaagatcctgttgtgcgggcctccgcccatg
gttagcgggctgaagaaggcgaccgagagtctcggcttcaagaaggcccgccccgtcagc
aagctggaggaccaagtgtttgccttttaa

DBGET integrated database retrieval system