KEGG   Myceliophthora thermophila: MYCTH_2305193Help
Entry
MYCTH_2305193     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
mtm  Myceliophthora thermophila
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    MYCTH_2305193
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    MYCTH_2305193
   04113 Meiosis - yeast
    MYCTH_2305193
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MYCTH_2305193
Ubiquitin system [BR:mtm04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     MYCTH_2305193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(3662745..3665117,3665177..3665251)
Genome map
AA seq 815 aa AA seqDB search
MAPTSAAIAGLLKQTVYYHLDSLSYRNALFFAERLHAHDQRSPESTFLLGLSYLHLGDPR
SAYEVSKLPGCRGIHLGCSFVFAQACLDLERYKDGIAALEKARPLWAAKGNTIGRHTTST
RAPYPDAAAVSCLLGKLYRGYEDKKRAVSCFEDALRANPFMWDAFTILCDMGVNVVVPNI
FKLNDSFARSFDQDPGAISIDSSGGPPDPLQRKIGVQGVSHDGHPFEGHRSTAFQDVSSN
NMLFVDPAENDVASRLTAGHITTRYAANKHGLEGMETPTSSVSGAEAPPPRAGFPPEPPL
APSRRTRAAQATEPTFLDAPPKMSYRLGSRRRDRTQDQMGEPPEPPPPTRGPVLTQPSVT
ERKRTASGHPVQPRPINGEEPRRSARLNVAPRTTSRTNANVPTAGTTVTRELKKARPPIS
RIGRPGSSGTGVGRVVSGNRKPTEENSMDVDEAPRVKDLPTAQVPPPKPAEPELLRADEG
LKWILDFLKKMASGYRLSSQFQCQEALAAFSSLPRIHQDTPWVLARMARAHYELANYADA
EKFFRRLRALAPTRHEDMEFYSTVLWQLRKGTELSFLAHELTDMDWDSPQAWCVMGNAFS
LDCDHEQALQCFKRAIHLQPKSAYAHTLQGHEHVENEEYDKALVSYRRAIAADKRHYNAY
YGIGKVYEKLGNYDKALSHYHAALVIHPAHAVLICCLGTVLQRQKQIVQALPYFTKAVEL
APRAPEMRSKRAGALLATGQLEEAKRELMILRDVAPNNAQVHFLLAKLAKTVGDKRTAVR
HFTIALSLDPKASGEIKNEIGGLEDEEHLDDTMIH
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaccagcgcggccatcgctggcttgttgaagcagaccgtttactaccatctc
gacagcctctcctaccggaacgccctcttcttcgccgaaaggttgcatgcccacgaccag
cgctcgcccgagtccaccttccttctcggcctctcctatcttcacctcggcgacccgcgg
tctgcatacgaagtcagcaagttgccggggtgtcggggaatccatctgggctgctctttc
gtctttgcacaagcctgtctagacctggaacggtacaaggatgggattgcggcgttagag
aaggcccggccgttgtgggcagccaagggcaacaccatcgggaggcacacgacctcgacg
cgggcgccataccccgatgcggccgcagtgagctgcctcctcggcaagctataccgagga
tacgaagacaagaagcgcgcggtttcctgtttcgaggatgccctaagagccaaccccttc
atgtgggacgccttcaccatcctttgcgacatgggcgtcaacgttgtggtgcccaacata
ttcaagctcaatgacagttttgctcgcagtttcgaccaggaccccggcgcgatcagcatc
gactcgagcggcgggcctccagaccccctgcaaaggaagattggcgtccaaggtgtcagt
cacgacggccacccgtttgagggacaccgctcgacagcctttcaagacgtttcaagcaac
aatatgctatttgtcgaccctgccgagaacgatgtggcgtcgaggctaactgctggccat
attaccacaagatatgcggcaaacaagcacgggctcgagggtatggagaccccaaccagc
tctgttagcggcgccgaggctccgccgcctcgcgcgggctttcctcccgaaccaccatta
gcgcctagccgacggactcgggcggctcaggcaacagaacccaccttcctcgacgcccca
ccaaagatgagttaccggttaggctcccgaaggagggacaggactcaagatcagatgggc
gagcctccagaaccgccaccacccacgcgcgggcctgtccttacccagccgtccgtcaca
gaaaggaagcgcaccgcgtcaggacaccccgttcagccgcgcccgatcaacggcgaggag
ccgaggaggagcgctaggctgaacgtggccccgagaacaacgtcgaggaccaatgccaac
gttcccacggctggcacaaccgttacccgcgagctgaagaaggccaggcccccgatatcg
aggattgggcgccctggttctagcggaaccggcgtcggcagggttgtgagcggaaatcgg
aagcccacggaggagaacagtatggatgttgacgaggccccgcgggtcaaggacctgccc
acggcgcaagtccctccaccgaagccggccgagcccgagttgctcagggcagatgagggg
ttgaaatggatactagatttcctgaaaaagatggcatctgggtatcgcctctcatcgcag
ttccagtgccaggaagcgctggctgctttctcctcactcccccggatccaccaggacacg
ccctgggtgttggcgcggatggcgagagcccactatgaattggctaactatgcggacgcc
gaaaagttcttcaggcgcctacgcgcgctcgccccgacacggcacgaggacatggagttc
tactcgaccgttctctggcagcttaggaaggggacggaactctcgttccttgcgcacgag
ctgaccgacatggactgggactcgccacaagcctggtgcgtgatggggaatgcgttctcc
ctggactgcgatcacgagcaggcgctgcagtgcttcaagcgagccattcatcttcagccc
aagtccgcatacgcccataccctgcaggggcacgagcacgtggaaaacgaagagtacgac
aaggcccttgtgtcataccgacgtgccatcgctgcagacaagcggcactacaacgcctat
tacggcatcggaaaagtctacgagaaactcggcaactacgataaggcgctgagccattat
cacgcggcgcttgtgatccacccggcccatgccgtgctgatttgctgcctgggtacggtg
ttgcagagacagaaacagattgttcaagctcttccttacttcaccaaggccgtcgagcta
gcgcctcgagcaccggagatgcggagtaagagggccggggcactgctagccaccggccag
ctggaggaagcgaagagggagctgatgattctgagggacgttgcgccgaataatgcccag
gttcacttcctgctagccaagctcgccaagactgtgggtgataagaggaccgccgtgcgt
cacttcaccatagccctgagtttggatccaaaggcgagcggggaaatcaagaacgaaatt
gggggactggaagacgaagagcatttggacgacaccatgattcactga

DBGET integrated database retrieval system