KEGG   Myceliophthora thermophila: MYCTH_2305269Help
Entry
MYCTH_2305269     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCTH_2305269
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCTH_2305269
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MYCTH_2305269
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MYCTH_2305269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(3739404..3739443,3739505..3739692,3739753..3739863,3739922..3740192,3740254..3741278)
Genome map
AA seq 544 aa AA seqDB search
MRGPRPLGVVIKLGTSSIVDEKTHEPLLSILTSIVETAVKLRKDGHRVIIVSSGAIGVGL
RRMDVEKRPKHLSKLQALAAIGQCRLMSLWDSLFTHLMQPIAQILLTRNDIADRSRYLNA
QRTFNELLDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVHADLLFLMTDVDCLYDK
NPRTHPDAHPIEVVEDIGSLVADVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITRSSN
PGNIVKIVKHIQASRSPPSLVTKANQTTTSVAAAAAAAAAANPGRAAQRAAEQETSPACP
THTGLAPAGATPAPNKIPLHTRFLPSPHPVRDRYFWILHGLRPHGTLYIDQGAYKALLGK
AGLLPVGVVDVEGNFAQHEAVRLCVVERRRKKKKKNKGQRKDGKGKAKGGRSQGDSGAQK
NSGEENEEEEREKENEIPDREPGDEEDGSEVDDDSDGDDKLWEGEPREVGRALSNYSSSE
IARIKGRQSAEVEGILGYADSEYVAQRESISFFDSVRGSRPATPVREVLDGKGIGGYEVE
GAVF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagggggccacgtccgcttggcgttgtgatcaagctcgggaccagctccattgtcgac
gagaagacccatgagcccctcctctctatcctgacgtcgatagtggaaacggcagtgaag
ttgaggaaagatggtcacagggtcatcattgtctcctccggcgccatcggcgttgggctg
cggaggatggacgtcgagaagaggccgaagcatctttccaagctgcaggcacttgcagcc
atcggccagtgccggctcatgagtctctgggacagcctgtttactcacctcatgcagccc
attgcccagatcctcttgacaagaaacgacattgccgataggtcacgctatctcaatgcc
cagaggacattcaacgagctgctcgacatgggcgtcattcccatcgtcaacgagaacgac
acgctggcagtgtcggaaatcaagtttggcgataatgacacgctctcggctatcacagcg
gccatggtacacgcagacctgctcttcctcatgaccgacgtcgactgcttgtacgacaag
aatccgagaacccaccccgacgcccaccctatcgaggtggtcgaggatatcgggtccttg
gtagcagatgtctcaactgctggttcctcactcggcacaggcggcatgtctaccaagatc
gtcgccgctcgcctcgccacctcagccggcgtaacaaccgtcatcacgcggtcttccaac
ccaggcaacattgttaagattgtcaagcacatccaagccagccgctcaccgccttccctc
gtcaccaaagccaaccaaacaacaacatcagtagcggcggcggcagcagcagcagcagca
gcaaaccccggccgagcagcccagcgtgccgccgaacaagaaacctccccggcttgcccc
acccacaccggcctcgcgcccgcgggagcaacgccggccccgaacaagatccccctccac
acgcgtttcctaccctctccgcacccggtccgcgaccgctatttctggatcctgcacggc
ctgcggccccacggcacgctgtacatcgaccagggcgcctacaaggcgctgctgggcaag
gccggcctgctgccggtgggcgtggtggacgtggagggcaactttgcgcagcacgaggcc
gtgaggctctgcgtggtggagaggaggaggaagaagaagaagaagaataagggacagagg
aaagacgggaaagggaaggccaagggaggtaggagccaaggagattcgggggcgcagaag
aacagcggggaagagaacgaggaggaggaaagggagaaggaaaatgaaattcctgataga
gaaccgggtgatgaggaggatgggagcgaggtcgatgatgacagcgacggtgacgataag
ctctgggagggtgagcctcgcgaggtgggcagagcgctgagcaattactcgagctccgag
atcgcgaggatcaaggggcggcagagtgcggaggtggagggcatcctggggtacgcggac
agcgagtatgtcgcgcagagggagagcatcagcttctttgattcggtcagggggagcagg
ccggctacccccgttcgggaggtgctggatgggaaggggattggggggtatgaagtagaa
ggggcggttttttga

DBGET integrated database retrieval system