KEGG   Myceliophthora thermophila: MYCTH_2306314Help
Entry
MYCTH_2306314     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mtm  Myceliophthora thermophila
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MYCTH_2306314
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MYCTH_2306314
Transfer RNA biogenesis [BR:mtm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MYCTH_2306314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:1766863..1767930
Genome map
AA seq 355 aa AA seqDB search
MASPYARELEIAQLAVQRAAILTKRVFHEKAKGTVSKDDASPVTIGDFGAQALIIAALRA
NFPGDAIVAEEEAAQLRSDDKLREPIWGLVRDTKLEDDAAERLLGGGVKDVDDLLEVLDL
GRSPGGRKGRVWTIDPIDGTKGFLRGGQYALALALLEDGDVKVGVLGCPNLPVDDEAPLA
ADIGANQTDAEGRGVIFSAVVGQGATSRPLGTGGLAQGKRIKMKEVTDMASASFCESVES
CHSNQSEAAQIAQRLGITKPSVRMDSQAKYGSIARGAGDIYLRLPTSKTYQEKIWDHAAG
DLIVREAGGQVTDTKGQRLDFGVGRTLATNSGVIAAPAAVHGRVLEVVQEVLGLK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccttacgcgcgtgagctcgagatcgcccagctggccgtgcagcgcgccgcg
atcctcaccaagcgcgtcttccacgagaaggccaaggggaccgtctccaaggacgacgcc
tcgcccgtcacgattggcgactttggcgcgcaggcgctcatcatcgccgcgctgcgtgcc
aacttccccggcgacgccattgtggccgaggaggaggccgcgcagctgcgcagcgacgac
aagctgcgcgagccgatctgggggctcgtccgggacaccaagctggaggacgacgcggcc
gagcggctgctgggcggcggggtgaaggatgtggacgacctgctcgaggtcctcgacctc
gggcggagcccgggcggcaggaaggggcgggtgtggacgatcgacccgatcgacgggacc
aaggggttcctgaggggcgggcagtacgcgctggcgctggcgctgctggaggacggggac
gtcaaggtgggcgtgctggggtgccccaacctgccggtcgacgacgaggcgccgttggcg
gcggatatcggggccaaccagacggacgcggaggggaggggcgtcatcttctcggccgtg
gtgggccagggtgcgacgagccggccgctggggaccggcgggctcgcgcaggggaagcgg
atcaagatgaaggaggtcaccgacatggcgagcgccagcttctgcgagagcgtcgagtcc
tgccactcgaaccagtccgaggctgcgcagatcgcccagaggctgggcatcaccaagccc
agcgtcaggatggactcgcaggccaagtacggctcgatcgcccgcggcgctggcgacatc
tacctacgcctgccgacctccaagacgtaccaagagaagatctgggatcatgcggccggg
gacctgatcgttcgggaagcgggtggccaggtgaccgacaccaaggggcagcgtctcgac
tttggcgtcggcaggacgctggcgaccaacagcggcgtgatcgccgctcccgccgcagtc
cacggacgcgttctcgaggtcgtacaggaagtgctcgggctgaaatga

DBGET integrated database retrieval system