KEGG   Myceliophthora thermophila: MYCTH_2306355Help
Entry
MYCTH_2306355     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
mtm  Myceliophthora thermophila
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCTH_2306355
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCTH_2306355
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2306355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(1808477..1810612,1810666..1811601)
Genome map
AA seq 1023 aa AA seqDB search
MPGSTTMLNDAPSGTLSGRSDGAKGGKRPLPHIDDITSVTVDVDPYAPVEKVLQAAESYL
RQAESSKNFGRPDLALKDYIRTNILLLDVVKQNKGWVSLQRDNRAQFERYQRLVRQVHAA
HGDFEAIKDQIKADNARTGVEPTSRSAGSAGKGAAINGQDKDTTPNGTAKENGVAASPPP
RSKPVVHPKPKNLHGNALPPGPGAATQAKAQDLVQRFANLRAGANNASRGAHARTQSEMS
PARIGSLASSEVPLSSPPLNGAIPELPRMPAAIYNPPRGTISSETAALPTSAPRAMFTRT
SSAASLSTVKANNPPRSPEGAASTSASVKRARPAVPDGDTISVEDLLRCMRTGAKDLSIL
LIDIRSREDFDEGHVMSQATICVEPEILTRDHISANQVADSMVLAPAAEQLLFEKRHEFD
LVVFYDQNSEQIPDRPQTPQAKAVSGLFNALSQYDFPGASGLKISPKLLRGGIEAWTSLV
GSASLQSSSTTASRKYPASPMTRSFLNSRQKYVTRPIQDPAEAKRWEDTIADTGGISPVR
TTEDFLRRFPPISEHKESMVSPASPPMSRPQSPFQSRLSHEENLYKSLPSPPTRPPPAVP
RRSYSGLAEAEDNSLVLAKKSGPQVVDTVRKFRTGLQNPGVFCFANSSLQAMFATPGFAR
EIWTGAWKELYKVPMKPDEKFENPQLLIKCLTNLFHWLNQGSLRSLAAKTFMEYIHFIHS
KSSDGKKKPDCDIFGGSSQQDAQEFYSFIMDNIHDETNVRRDVKPSKEEKPYTPKDGTII
QNAMDYWRDYSKYSASIIDKYFRGLEVFISRCHNPACRQEIRLFQPCDVWILNLAGMGDP
TDLDSLLANHQTSEHFPDLVCETCNKPGRTRKAKFARLPDRLAFCLNRFNSAGAGGGGFS
NRFMSSGKIHSKVRFPIRDLDLTRYCAEPDPDMATTDDRHFAGKMRYDCYAVTVHVGQGI
NGGHYYSYVQDETSKDPTDWFRCNDEVVDRVKIGSGQPGDMTEAMYQNGNTSAYMVFYRR
QGT
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctcgactaccatgctgaacgatgcgccttcaggaaccctgagcggacgttcc
gatggcgcaaaaggcgggaagcgaccgttgccgcatatcgacgacatcacctccgtcact
gtagacgtcgacccgtacgcgcccgtcgagaaagtccttcaggcggcagagagctatttg
cggcaagctgagtcgtccaaaaattttggccgacccgaccttgcgctcaaagactacata
cggaccaacattcttcttctcgatgtcgtaaagcagaacaagggatgggtgtcactacag
cgcgacaacagggcccaatttgagcgataccagcggcttgtacggcaggtacatgccgcg
cacggagattttgaggctatcaaggaccaaataaaggccgacaacgcgagaacgggggtt
gagcccaccagtcgctccgcaggatcggctggaaagggtgctgctatcaacggacaggat
aaggacacaaccccaaacggcaccgcaaaagagaacggtgttgcggcgtcgcctccaccg
agaagcaagcccgtcgtccacccaaagcccaaaaatctccatggaaatgcgctaccgcca
ggaccgggggcggccacccaggccaaggcccaggaccttgttcagcgtttcgcaaacctc
cgagcgggcgcaaacaacgcttcccgcggcgcacacgctaggacacaatcagaaatgtcg
ccagcgcgaatcgggtcgctggcatcctcagaggtgccgctttcgagtccgccgttgaat
ggcgctattcccgagttaccccggatgcccgccgctatttacaacccaccacgaggcact
atctcgagcgagacggctgctcttcccaccagcgctcctcgcgccatgtttacgaggact
agttcggcagcctctctaagcactgtcaaagcgaacaatccaccacgttctcctgaaggc
gcagcatccacaagcgcttcagtgaagcgggctagaccggctgtcccagatggggacaca
atatctgttgaggatctgctccggtgcatgaggactggcgccaaggacctgtctatcctt
ctcattgacatcagaagtcgtgaggatttcgatgagggtcatgtcatgtcgcaggccact
atctgcgtcgagcccgagatactcacaagagaccatatttcggcgaatcaagttgcagat
agcatggttttggcgccggcagccgagcaactactcttcgaaaagcgccacgagttcgac
ttggtagtgttctacgaccagaactccgagcagatccctgacagaccgcagacaccccaa
gcgaaggctgtatctggcttgttcaatgccctcagccaatatgatttcccaggtgcatca
gggttgaagatttcgccgaaattgttgcgagggggtatagaagcgtggaccagtctggtg
ggcagcgcgagtctgcagtcctcctcgacgacggcgtccagaaagtacccagcaagcccc
atgacacggtcgtttctcaactcgcgccaaaagtatgttactcgaccaatccaggatccg
gcagaagccaagcggtgggaggataccattgccgatactggtgggatatcacccgtcagg
acaaccgaggactttctccgccggttccctcccatttcggagcacaaggagtcgatggtg
tctcccgccagccctccaatgagtcggccgcagagcccttttcagtctcgcctctctcac
gaagagaatctttacaagtccctcccgtcgccaccgacgcgcccgcctccagcagtcccc
cggagaagctacagcggacttgccgaagccgaagacaattccttggtgctggccaagaag
tccgggccccaagttgtcgacacagtgcgaaagtttcggacaggtctgcagaatccgggc
gttttctgttttgcgaacagttctttgcaagccatgttcgccacgccgggctttgcgcgc
gagatatggacaggggcttggaaggaattgtataaggtgcctatgaagccggacgagaag
tttgagaatccccagcttctcatcaagtgcttgaccaacctgtttcactggctcaaccaa
ggttcactccgatcactcgcggctaagacgttcatggaatacatccatttcatccactct
aagagctcggacggtaaaaagaagccggactgcgacatcttcggaggctcctctcagcag
gacgcccaagagttctactctttcatcatggacaacattcatgacgaaacaaacgtccgt
cgggacgtgaagccttccaaggaagagaagccctacacgccaaaggacggcaccatcatc
caaaacgccatggactattggcgcgactattccaaatacagcgcctcaatcatagacaag
tacttccgcggcctcgaggttttcatctcacgctgccacaaccccgcctgtcgccaggag
atccgcctcttccagccgtgcgacgtctggattctcaacctcgccggcatgggtgaccca
accgaccttgacagcctgctcgccaaccatcagacctcggagcacttccccgatctggtc
tgcgagacatgtaacaagcccgggcgcacgcgcaaagccaagtttgcgcgcctccccgac
cgcctcgccttctgcctcaatcgctttaacagcgccggcgccggaggcggcggcttcagt
aaccggttcatgtcgtcgggcaagatacatagcaaggtccggttcccgatccgcgacctc
gacctgacgcgctactgtgccgagcccgacccggacatggcgacgacggatgaccgccac
tttgccggcaagatgcggtacgattgttacgccgtcacggtgcatgtcgggcaggggatc
aatggcgggcattactacagctacgtgcaggacgagacatccaaagacccgaccgattgg
ttcagatgcaatgacgaagtggtcgaccgtgtcaagatcgggagtgggcagccgggagat
atgaccgaggccatgtatcagaacggtaatacgtcagcgtacatggtcttctatcggcga
caggggacatga

DBGET integrated database retrieval system