KEGG   Myceliophthora thermophila: MYCTH_2306784Help
Entry
MYCTH_2306784     CDS       T02231                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mtm  Myceliophthora thermophila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCTH_2306784
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MYCTH_2306784
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYCTH_2306784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(2443039..2443056,2443125..2444452,2444510..2445778,2445851..2445969,2446262..2446311))
Genome map
AA seq 927 aa AA seqDB search
MSTLDGDLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRTLIEQHHLGSVLLTAKNLKSAEQ
TARLVQELQTIARQAGHPYPLLIALDQENGGVNSLFDEDYICQFPSSMGQAAASSADLAY
KIAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRATGDDPQEVSQYGIAAMNGYKDA
GVATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALVPFRNAIATGKLDAMFVGGCG
IANPSMNVNHACLSEQVVDDLLRNELGFQGVAISECLEMEGLRNEIGVKTGTVMAVEAGC
DLVMLCRAYDVQLEAISGLKLGVENELITKERIYTSLRRIVRMKKSCTSWQKALNPPGIS
LLSKIHPGHLALSLKAYDDSIAVIRDNEKLLPLTSSMHQEEELLLLTPLVRPLPASSMTK
ALLEKKQIDPVTLHDKWVHRDRGAIMSGEGVFRELGRSLARARHGKLLHTSYTANGVRPV
HENLINRASCIIIVTADANRNLYQAGFTKHVSMMCSLLRANGQKKSLIVVAVSSPYDFAM
DKSVGTYICTFDFTETAMAALVRVLCGKIKPRGTLPGTLRKSRKVLKSRQHWLVEPYDRD
RDAKGLQDLLQSLARASAPAHQFLQTTSAHSFELFSPNIEEAHFVVRNSSTQALYGFCAT
YFVQGTGIIGALFVDPAKRNVSIGRSLQRRALRGLTQKRGIKKVQLGMSFPGVFLGIPAD
DSAGLKQWFTNGGWDLQFPRRLVNMAVSSLNSWIAPEGLLQSIQRAGITFDLIHGLDNAD
NVLAHVSAHASPEVLELYRFALQETKSCGVVRAKGHAEALLGTVIVCKPGSTLASFIPPL
QPSPARPDEPVGGIVSPIVAPSSAQATLVLQGLALMGLRQNKTHKSLKSVLSWVQDDAHE
PLLAMGFEVVQVFEEFTNSPDNWQDFS
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttggatggcgatttggacccactatggcaggacctcgactgggccatcggt
cagatgctgattatgggatgggatgggaccgaagtcacaccccagatccgtactctaatc
gagcagcatcacctgggctcggtcctgctaacggcaaagaacctcaaatccgccgagcaa
acggcaagactcgtccaggagctccagaccatcgcccgtcaggccggccatccctacccc
ctgctgattgccctcgaccaggagaatggcggcgtcaacagcctctttgacgaggactac
atctgccagttccccagctccatgggccaggctgccgccagcagtgccgacctggcctac
aagatcgccaaggccaccgctaccgaagtctcggccgtcggtgtcaacctgatcttggga
ccagtgctggacgtgctcaccaatgcgcgctaccagccgctgggcgtgcgagcgaccggc
gacgacccccaagaggtctcccagtacggcatcgccgctatgaacggctacaaggacgcc
ggcgttgccacctgcgggaaacacttcccttcctacggcaacctggattttctcggctcc
agcttggacatccccatcatcacccagaccctggaggaactctctctgagcgcccttgtt
cccttccgcaacgccatcgccaccggcaagctggacgccatgtttgtcggtggctgtggc
atcgcgaacccgtccatgaacgtcaaccacgcgtgtctgtctgaacaggtggtcgacgac
ctgctcagaaacgagctcggcttccaaggtgtcgccatctcggagtgtttggagatggag
ggtctcaggaacgagattggcgtcaaaacgggcacggtcatggcagtcgaggccgggtgc
gacttggtcatgctctgtcgcgcctacgatgtgcaactcgaggccatttccggcctgaaa
ctgggcgtggagaatgagctcatcacgaaagagcgcatctacacgtcgctcaggcgaatc
gtccgcatgaagaagtcgtgcacttcctggcagaaggcgttgaaccctcccggcatcagc
ttgctgtccaagatccatccgggccacctcgcactctcgctgaaggcctacgacgactcc
atcgccgtcatacgagacaacgaaaagctgctccccttgacctcttccatgcaccaggaa
gaggaactgctgctgctcacgccactggtaaggccgctaccggcttcctccatgaccaag
gcgttgctggagaagaaacaaatcgaccccgtaacactccacgacaaatgggtccaccgt
gatcggggagccatcatgagcggcgagggagtatttcgcgagctcggaagatccctcgct
cgtgcaaggcatgggaagctgctacatacatcttacaccgcgaacggtgtcaggccagta
cacgaaaacctcatcaaccgagcctcgtgtatcatcatcgtgacggcggacgccaaccgc
aacctgtaccaggcaggctttacaaagcacgtctccatgatgtgctcattgctgagggca
aatgggcagaagaagtcgctcatcgtggttgccgtcagctccccttacgacttcgcgatg
gacaagtcggtcgggacctacatctgcacctttgacttcaccgagacggctatggccgct
ctcgtacgggtcttatgcggcaagatcaagccccggggcacactgcccgggaccctcagg
aagagcagaaaggtgctcaaatccaggcagcactggctcgtcgagccgtacgaccgcgac
cgagacgccaaggggttacaggacctcctacaatccttggccagagcgagcgcgcctgcc
caccagttcctgcagaccacgagcgcgcattcctttgagctgttcagccccaacatcgag
gaagcccacttcgtagtgcgcaacagcagcactcaggcgctctacggcttctgcgcaacc
tactttgtccaagggacgggaattatcggcgctctctttgtcgaccccgccaagcgcaat
gtctccatcggcaggtccctccaacggcgagccctgcgcggcttgacccagaagcgcggc
atcaagaaggtacagctgggcatgtccttcccgggcgtcttcctaggcatccccgcggac
gacagcgccgggctcaagcagtggtttaccaacgggggttgggacctgcagttcccacgg
cgcctcgtcaacatggccgtctcatctctcaacagctggattgcccccgaagggctgctg
cagagcatccagcgcgccggcatcaccttcgacctcatccacggcctggacaatgccgac
aacgtgctggcccacgtcagcgcacacgcaagcccggaggtgctggagctgtaccgcttc
gcgctgcaagagaccaagagctgcggtgtcgtccgggccaagggccacgccgaggcgctg
cttggcacggtaatcgtctgcaagcccgggagcaccctggccagcttcatcccgcccctg
cagccctctccggcgcggcctgacgagcctgtcggggggatcgtgagcccgatcgtggcg
ccgtcgtcggctcaggcaaccttggtgctgcagggtctcgccctgatgggcctgcggcag
aacaagacgcacaagtcgctaaaaagtgtgctgagctgggtgcaggatgacgcgcatgag
ccactgttggctatgggattcgaagtggtgcaggtctttgaggagtttacgaattcgccg
gataattggcaggacttttcttga

DBGET integrated database retrieval system