KEGG   Myceliophthora thermophila: MYCTH_2307126Help
Entry
MYCTH_2307126     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
mtm  Myceliophthora thermophila
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mtm03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mtm03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:3079595..3081133
Genome map
AA seq 512 aa AA seqDB search
MSVGQQSYQLSDYLEKLPGTTFRKLYQQPSTAFAIFRRMLPPLAKVFVQALLYMPSPMLL
SELDVWVRPEGKMQRDRALSILRSLHIVQITPPGKDKPQEIQLTTNFRNSLRLALEGGGT
HNSFGVPSTLPVDPRIDIAYLDSYARRKWEDILHYVVNSVPAQGEGGGGGSVGGPKASVK
DLLLIGRLVERRNDTKAGVGITQAGFTFLLQEANAQVWTLLLLWLEAADRAKGAAEQGKG
GGAAAAAAKADSIDMLSFLFMLASLELGRAYDTDALSETRRNMLPALVDFGLIYIPREDT
RQYFPTRLATTLTSSASSLRSVSSGFSAAAANNPGDASSLGTTPETSAASKGSVIIETNY
RLYAYTSSPLQIAVLALFTQLNMRFAGMATGRLTRDSIRRAIGFGITADQIISYLASHAH
EQMVRAAAATGRPVLPPTVVDQIRLWQLENERMRTSAGFLFKDFDSLDEYLSLSAYAEEI
GVLVWKSDKKRMFYASKIEQLRDYLRSRKRAE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcggccagcagtcgtaccagctctccgactatctggagaagctgccgggcacc
acctttcgcaagctctaccagcagccctccaccgcctttgccatcttccgccgcatgctg
cctcccctggccaaggtcttcgtccaggcgctcctctacatgccctcgccgatgctgctc
tccgagctcgatgtctgggtgcgccccgaggggaagatgcaacgcgatcgggccctctcc
atcctgcgatcgctgcacattgtccagatcaccccgcccggcaaggacaagccgcaggag
atacagctcacgaccaatttcagaaacagcctgcgtctggccctcgagggcggcggtacc
cacaacagcttcggcgtgcccagcaccctgccggtcgacccccggatcgatatcgcctat
ctcgacagctacgcccgcaggaaatgggaggacattctgcactacgtcgtcaacagcgtg
cccgcgcagggggaagggggcggcggcgggtccgtcggaggccccaaggccagcgtcaag
gatctgctgctgatcgggcggctggtcgagcgcaggaacgacaccaaggccggggtcggc
atcacccaggccggcttcaccttcctcctccaggaggccaacgcgcaggtctggacgctg
ctcctgctctggctcgaggcggccgaccgcgccaagggggcggccgagcagggcaaaggc
gggggggcggcggcggcggctgccaaggcggacagcatcgacatgctgtctttcctcttc
atgctcgcctcgctcgagctcgggcgggcatacgacacggacgcgctcagcgagacgcgc
cgcaacatgctcccggccctcgtcgacttcggcctcatctacatcccgcgcgaggacacg
cgccagtacttccccacccgcctggccacgacgctgaccagctcggcctcgtccctccgc
tccgtctcgtccggcttcagcgccgccgccgccaacaacccgggcgacgcctccagcttg
ggcacgacgcccgagacgtcggccgccagcaagggctccgtcatcatcgagaccaactac
cgcctctacgcctacacctcctccccgctccagatcgccgtcctcgccctcttcacccag
ctcaacatgcgcttcgccggcatggccaccggccgcctgacccgcgactcgatccgccgc
gccatcggcttcggcatcaccgccgaccagatcatcagctacctggcctcgcacgcccac
gagcagatggtgcgcgccgccgccgccaccggccggcccgtgctgccgcccaccgtcgtc
gaccagatccggctgtggcagctcgagaacgagcgcatgcgcacctcggccggcttcctc
ttcaaggactttgactcgctcgacgagtacctctctctgagcgcctacgccgaggagatt
ggcgtgctggtgtggaagagcgacaagaagaggatgttttatgccagcaagattgagcag
ctcagggactacttgaggagccgtaagagggcggagtga

DBGET integrated database retrieval system