KEGG   Thermothelomyces thermophila: MYCTH_2307126Help
Entry
MYCTH_2307126     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm03022  Basal transcription factors
mtm03420  Nucleotide excision repair
Module
mtm_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MYCTH_2307126
  Replication and repair
   03420 Nucleotide excision repair
    MYCTH_2307126
Transcription machinery [BR:mtm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MYCTH_2307126
DNA repair and recombination proteins [BR:mtm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     MYCTH_2307126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 11514236
NCBI-ProteinID: XP_003664371
JGI: 2307126
UniProt: G2QF97
Position
4:3079595..3081133
Genome map
AA seq 512 aa AA seqDB search
MSVGQQSYQLSDYLEKLPGTTFRKLYQQPSTAFAIFRRMLPPLAKVFVQALLYMPSPMLL
SELDVWVRPEGKMQRDRALSILRSLHIVQITPPGKDKPQEIQLTTNFRNSLRLALEGGGT
HNSFGVPSTLPVDPRIDIAYLDSYARRKWEDILHYVVNSVPAQGEGGGGGSVGGPKASVK
DLLLIGRLVERRNDTKAGVGITQAGFTFLLQEANAQVWTLLLLWLEAADRAKGAAEQGKG
GGAAAAAAKADSIDMLSFLFMLASLELGRAYDTDALSETRRNMLPALVDFGLIYIPREDT
RQYFPTRLATTLTSSASSLRSVSSGFSAAAANNPGDASSLGTTPETSAASKGSVIIETNY
RLYAYTSSPLQIAVLALFTQLNMRFAGMATGRLTRDSIRRAIGFGITADQIISYLASHAH
EQMVRAAAATGRPVLPPTVVDQIRLWQLENERMRTSAGFLFKDFDSLDEYLSLSAYAEEI
GVLVWKSDKKRMFYASKIEQLRDYLRSRKRAE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcggccagcagtcgtaccagctctccgactatctggagaagctgccgggcacc
acctttcgcaagctctaccagcagccctccaccgcctttgccatcttccgccgcatgctg
cctcccctggccaaggtcttcgtccaggcgctcctctacatgccctcgccgatgctgctc
tccgagctcgatgtctgggtgcgccccgaggggaagatgcaacgcgatcgggccctctcc
atcctgcgatcgctgcacattgtccagatcaccccgcccggcaaggacaagccgcaggag
atacagctcacgaccaatttcagaaacagcctgcgtctggccctcgagggcggcggtacc
cacaacagcttcggcgtgcccagcaccctgccggtcgacccccggatcgatatcgcctat
ctcgacagctacgcccgcaggaaatgggaggacattctgcactacgtcgtcaacagcgtg
cccgcgcagggggaagggggcggcggcgggtccgtcggaggccccaaggccagcgtcaag
gatctgctgctgatcgggcggctggtcgagcgcaggaacgacaccaaggccggggtcggc
atcacccaggccggcttcaccttcctcctccaggaggccaacgcgcaggtctggacgctg
ctcctgctctggctcgaggcggccgaccgcgccaagggggcggccgagcagggcaaaggc
gggggggcggcggcggcggctgccaaggcggacagcatcgacatgctgtctttcctcttc
atgctcgcctcgctcgagctcgggcgggcatacgacacggacgcgctcagcgagacgcgc
cgcaacatgctcccggccctcgtcgacttcggcctcatctacatcccgcgcgaggacacg
cgccagtacttccccacccgcctggccacgacgctgaccagctcggcctcgtccctccgc
tccgtctcgtccggcttcagcgccgccgccgccaacaacccgggcgacgcctccagcttg
ggcacgacgcccgagacgtcggccgccagcaagggctccgtcatcatcgagaccaactac
cgcctctacgcctacacctcctccccgctccagatcgccgtcctcgccctcttcacccag
ctcaacatgcgcttcgccggcatggccaccggccgcctgacccgcgactcgatccgccgc
gccatcggcttcggcatcaccgccgaccagatcatcagctacctggcctcgcacgcccac
gagcagatggtgcgcgccgccgccgccaccggccggcccgtgctgccgcccaccgtcgtc
gaccagatccggctgtggcagctcgagaacgagcgcatgcgcacctcggccggcttcctc
ttcaaggactttgactcgctcgacgagtacctctctctgagcgcctacgccgaggagatt
ggcgtgctggtgtggaagagcgacaagaagaggatgttttatgccagcaagattgagcag
ctcagggactacttgaggagccgtaagagggcggagtga

DBGET integrated database retrieval system