KEGG   Myceliophthora thermophila: MYCTH_2307294Help
Entry
MYCTH_2307294     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mtm  Myceliophthora thermophila
Brite
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   MYCTH_2307294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(3418360..3418424,3418509..3418579,3418639..3419967,3420136..3421022,3421216..3422457,3422516..3425767,3425843..3426313)
Genome map
AA seq 2438 aa AA seqDB search
MSIIKDQAATALDQYIKEVRNRNHAEDQRKRAARQVRDLVNIAKQEMGTEQFQRFFDTVN
QRTMALIQSTDTYDKMGGVYILDALVDFEGIEPALKYSRFQQYIGTILRGKDLNPMQPAA
VVLGKMCKPGGSLISELVDAEMHTALEWLQSDRVEERRYSAVLVLRELARNAPTLMYPYV
GFVFDQIWIGLRDPRHLIRATSSETVSACFKIIRERDQEMKQEWMDKMFNEAVKGLKVNT
VEYIHASLLVLKELLEQGGMYMQSHYQEACEIVFRHKDARDPAIRKTVVFLIPDLANYAP
TEFGATYLHKFMVYLSGMLKKEKERNDAFLAIGNIANSVKSAIAPYLDGVLIYVREGLSV
QSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACELTPKLTQALVDMAFYIPPV
KGTIQERLLNMLSKVLCGEPFRPLGAPHLNPPSSIPPIPKDPKDPSVHERGKAEVKLALN
TLGSFDFSGHVLNEFVRDVAIKYVEDDDPEIREAAALTCCQLYVRDPIVNQTSYHALQVV
ADVVEKLLTVGVSDPEPKIRRTVLAALDERFDQHLAKAENIRTLFFALHDEQFAVREVAV
SIIGRLARHNPAYVIPQLRKTIIQMLTELEYTDVARSKEESSKLLSLLTQHAQDLVKPYV
SSITEVLLPKASDPTPSVAATVLQAIGELCTVGGAEMLAKKDTLMPIIIDALQDQSAPIK
REAALHTLGQLASNAGYVIKPYLEYPQLLEILQSIIRGEPQHGPLRQETIKLMGILGALD
PYKHQVEERTPQTQRRPEATQLTDVSLMMSGLTPSQEDYYPTVVINALLQVLKDQSLVQW
HGNVVDAIMSIFITLGLKCVQFLDRVVPAFIAVIRASSPARLDYYFNHLSRLVGIVRQHI
RVYLPDIIEVLQEFWNTTSSLQTTIISLIESIARSLEGEFKIYLASLLPLMLGVLERDTS
TKRQPTEKIFHAFLVFGSSAEEYMHLIIPILVRLFDNPAQPMFLRKSSIETIGKLSSMVN
LNDYASKIIHPLTRVLASQEPSLRVAALDTLCALMLQLGRDYLHFEHTVEKTITMYGIQH
SNYDKAVEKLKKGEALPQNLAPRFEDTSLEQFTSENNPPKKLDLNPVHLKQAWETKGKAT
KDDWHEWFRKFSTTLLSESPNHSLRACASLASNYQPLARELFNSAFVSCWSELYDSYQEE
LITNIENTIKSENVPPDLLGQLLNLAEFMEHDDKALPIDIRILGREAARCHAYAKALHYK
ELEFLQDHNSHAVEALIVINNQLQQSDAAIGILRKVKAYKDGIQLRESWFEKLERWDEAL
NFYCQRERELPEDQPTPVDIVMGKMRCYHALGEWDSLASLAGKTWANSGPEIQRRIAPLA
TTAAWGLGKWDSMDTYLQSMKRYSPDRAFFGAILALHRNQFREALACIEQAREGLDTELS
ALVSESYNRAYQVVVRVQMLAELEELIVYKQCGPEKRATLRATWETRLKGCQRNVEVWQR
TLRLRSLVLTPQENMHMWTKFANLCRKSGRMGLAEKSLKQLIDTDAPLESVIPYWADQSP
NPGVERIAPPIVYAVLKYQWEVGQQPGVRNTDRSIAERTLYCLHRFTEDMARRVESARLQ
LNASTQAVNGMGDGLNHARYTDYDEAAVLGPDAQHQLLEQTVLLAKCYLRQGDWMITLNK
NDWQHTRRQDVLDCYSKATHYHPRWYKAWHAWALANFEVVQALTSKKELEGRSEHSIIVH
HVVPAVHGFFESIALSSGSSLQDTLRLLTLWLTYGGYQEVITAVTDGFAHVSIDTWLEVI
PQLIARINQPNRRVQASIHALLSDVGRAHPQALVYPLTVAMKSRQSTRRSKTASAIMESM
RQHSSKLVEQADLVSRELIRVAVLWHELWHEGLEEASRLYFGDHNIQGMFDVLEPLHDLL
EKGPVTLREISFTQTFGRDLSEAREWCRQYRHSQDVNDISQAWDLYYQVFRRISRQLPQM
TSLELTYCSPDLLQARDLELAVPGTYRSGQEIVRIKAFDGTLSVISSKQRPRKVVILGSD
GKTYTFLLKGHEDSRQDERVMQLFGLCNTLLANDSECYKRHLNIQRYPAIPLSQNSGLFG
WVPNSDTVHQLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQD
LYRVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKIIHIDF
GDCFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCEHVMRVLRDNKESVMAVL
EAFIHDPLLTWRLTNPASPAGPHFNSEREQAIAGPQAGRARRPSILDGPVAPTEFLAAQG
AAADGMMAPPPGARGRARTNSSAVAPGSLANGNGANDMAEVQNARAVEVLDRVTQKLTGR
DFKPHEELTVNEQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcatcaaagatcaagcggccactgcgctggaccagtacatcaaagaagtcagg
aatcggaaccatgcggaggatcagcgcaagcgcgccgcgcgccaggtgcgggacctggtc
aacatcgccaaacaagagatgggaaccgaacagttccagcggttctttgacaccgtcaac
cagaggaccatggcgctgatccaaagcaccgacacgtacgacaagatgggcggtgtctac
atcctggatgccttggtagacttcgagggcatagagcccgcgctgaaatacagccgcttc
cagcagtacatcggaacaatcttgcgcgggaaggatctcaaccctatgcagcctgccgcc
gtggttcttggcaaaatgtgcaagccaggcggctctctgatctccgagcttgttgatgcg
gagatgcacactgcgctcgagtggctgcagtcggaccgcgtggaggagagacgatacagc
gcagtccttgtcctccgcgagctggcgaggaacgcgcccacattgatgtatccctacgtc
ggtttcgttttcgatcaaatctggatcggcctacgagatcctcgccatctgatccgggcc
acttcgagcgaaaccgtcagtgcctgcttcaaaatcatccgggagcgtgaccaggagatg
aagcaagaatggatggacaagatgttcaacgaagcggtcaagggcctcaaggtgaacacg
gttgaatatatccacgcctcactccttgttctcaaggagcttctcgaacagggcggcatg
tacatgcagagccactatcaagaagcctgcgagatcgtcttccgtcacaaagacgcgcgc
gacccggccatccgcaaaacggtcgtcttcctcatccccgatttagccaactatgctcca
accgagtttggagccacttacctgcacaagttcatggtctacctatcgggtatgctcaaa
aaggagaaggaacggaacgatgcgtttctcgccattgggaacattgcaaactccgtcaag
agcgccatcgcgccgtacctagacggtgtcctcatttatgtccgcgaaggcctcagtgtg
cagtcccgcaagcgaggttctgtcgatccagtctttgactgcatcagccggctcgcggtg
gcggtgggccaaacgctgagcaaatacatggaggcgctgctggatcccatcttcgcctgc
gagctgacgccgaagctgacacaggccttggttgacatggctttctacatcccgcctgtc
aagggcaccatacaagagcgtcttctcaacatgctgagcaaagttctgtgcggcgagccg
ttccggccacttggagcacctcatctgaacccaccctcttccattccacccatacctaag
gatcctaaagatccatctgtgcatgagcgtggcaaagccgaggtgaagcttgccttgaac
acgctcggcagttttgacttttcaggccacgtcttgaacgagttcgtccgtgatgttgcc
atcaaatacgttgaggatgacgaccccgaaatccgcgaggctgctgccctcacttgctgt
cagctctatgtccgcgacccaatcgtcaatcaaacaagctatcacgctctgcaagtcgtc
gccgatgttgttgagaaactgttgaccgtgggtgtctcggaccctgaacccaagattcgc
cgaacggtgctcgccgccctcgatgagcgatttgaccagcacctcgccaaggccgagaat
attcgaacgctgttcttcgccctgcacgatgaacagtttgcggtgagggaagtcgccgtg
tcaatcattggtcgactagctcgtcataatcccgcatacgtcatcccccagttgcggaag
accatcatccagatgttgacagagctcgaatacacggacgtggcgaggagtaaggaggag
agctcaaagctgctaagcctcctgactcagcatgcccaagacctggtcaagccatacgtc
agctccatcactgaagtcctcttgccgaaggcctctgacccaacgccctctgtcgcggca
accgtcctgcaggccattggcgaactttgcacggttggcggtgctgagatgcttgctaag
aaggatacgctcatgccgattatcattgacgcattgcaggatcagagcgcacccatcaag
cgagaagcagccctccataccctcggtcagttggctagcaatgctggctatgttatcaag
ccttacctcgaatacccacagttgctcgagattttgcaatccatcattcgaggcgaacct
cagcatggtcccctgcgacaggagacgatcaagctcatgggtatccttggcgcgctggat
ccttacaaacaccaggttgaagagcgaacaccgcaaacccagcgtcgccccgaggctacc
caattaaccgatgtctctctcatgatgagcggacttacgccgtcccaagaggactactac
cccacggtcgtcatcaatgccctgcttcaagtcctgaaggaccaatccttggtgcaatgg
catggaaatgtggtggatgcaatcatgagcatcttcatcacgctcggactcaaatgtgtt
cagtttctcgaccgggtagttcccgctttcatcgctgtcatcagggcctcgagcccagcg
agactcgactactacttcaaccatctgagcagactcgttggtattgtgcgtcaacatatc
cgcgtctacctcccggacatcattgaggtgctgcaggagttttggaacacaacgtcctca
ctgcagactaccatcatctcactgattgagtcgatcgcccgttccttggagggcgagttc
aaaatctatctggcgagtctgcttccattaatgctcggggttttagagagggacacgagc
accaaacgccagccaaccgagaaaatattccatgcatttctggtgtttgggtctagcgcg
gaggaatacatgcatctcatcattcccattcttgtgcgcctattcgacaatccagcgcag
cccatgttcctgcgaaaatcgtcgatcgagacgatcggaaagctttcgagcatggtcaac
ctcaatgactatgcatccaagattatccaccccttgaccagggttctagccagccaagaa
cctagccttcgcgtcgctgcacttgacacgctctgtgctctcatgttacagttgggtcgc
gactaccttcattttgagcacacggttgaaaagaccatcaccatgtacggcatccaacac
tccaactacgacaaggccgtggaaaagctcaagaagggcgaggctctccctcaaaaccta
gctccccggtttgaggacacatctctggaacagttcacgtccgagaacaacccgccaaaa
aaactcgacttgaatccagttcacctgaagcaggcatgggagacaaaaggaaaggctacc
aaggacgactggcacgagtggttccgcaagtttagtacaaccttactttcagagtcgccg
aaccactcgctccgagcctgcgccagcctggcaagcaactaccagcctcttgctagggag
ctcttcaattctgccttcgtctcctgctggagtgagctctacgattcgtatcaggaggag
ctcattaccaatatcgaaaacacgatcaagtccgaaaacgtgccgcccgatctcctaggc
cagcttctcaatctcgcagagttcatggagcatgacgacaaggcacttcccatcgatatc
cgcatcttgggacgcgaagcggctaggtgtcacgcttacgccaaggcactccactataag
gagctcgagttcctgcaggaccataacagtcacgcggtcgaggcgctcatcgttatcaac
aaccaactgcagcagtctgacgccgccatcggtatcctgcgcaaagtcaaggcgtacaag
gacggtatccagctgcgagagagttggttcgagaagctagagcggtgggatgaggcgctc
aatttctactgtcagagagagcgggaactccctgaagaccagccaacacccgtcgatatc
gtcatgggcaagatgcgctgctatcacgcgttgggcgagtgggactcgctcgcctccttg
gctggcaagacttgggcgaactctggcccggagattcagcgaaggattgcgcccttggca
actacggctgcatggggtcttgggaagtgggattccatggacacctacctgcagtcgatg
aaacgttactcgcccgatcgcgcattcttcggggctattcttgccctgcaccggaaccaa
ttccgggaggcgctagcctgcatcgagcaggctcgtgagggcttggatacggagcttagc
gctcttgtaagcgagtcttacaaccgcgcttaccaggtcgtcgtgagagtccagatgctt
gccgagttggaggagcttatagtctacaaacaatgtggccctgagaagcgtgccacattg
cgagccacttgggagactcggctcaagggctgccagcgcaacgtcgaggtctggcagcga
acgctccggctgcgctctctggtgctcacgccgcaagagaacatgcacatgtggacgaag
tttgccaacttgtgccgcaagtccgggcgtatgggcctagccgagaagtccttgaagcag
ctcattgacactgatgctccgctggaatcggtcatcccttactgggctgaccagtcaccc
aacccaggtgttgagcgcatcgcacctccaattgtgtacgcagtgctcaagtatcagtgg
gaggttggccagcagccaggtgttcgaaatacggaccgcagcatcgcggaacgtaccctc
tactgccttcacaggttcaccgaggatatggcccgcagagtggagagcgcaagactgcag
ttgaatgcctctacgcaagctgtcaacggcatgggcgacggcctgaaccacgccagatac
accgactacgacgaggcagcggtccttggcccggatgcacaacatcaattgcttgaacag
acggtgctgctcgcaaaatgctacctccgacagggtgattggatgatcacgctgaacaag
aacgactggcaacacacacggcgccaagacgtccttgactgttattccaaggcaacgcac
tatcatccccggtggtacaaggcctggcatgcttgggctctggccaatttcgaggttgtc
caagctctgacctccaaaaaggagttggaaggaaggtccgaacatagcatcattgtccac
catgtggtgccagctgtgcatggcttcttcgaatccatcgcactctcctccggaagttcc
ttgcaagacaccctccgcttgctaactctctggctcacctatggtggctaccaagaagtc
atcaccgccgtcaccgacgggttcgcgcacgtcagcatcgacacctggcttgaggttata
ccacaactcattgcccgcattaaccaaccaaacagacgggtccaggcgtctatccacgct
ctcctgtccgacgttggacgcgcgcaccctcaggcgctggtctacccacttactgttgcg
atgaagtcgcggcagagtacacggaggtctaagacggccagcgcgatcatggagagcatg
cgtcagcacagttccaagcttgtggaacaggccgatcttgtgagccgcgagcttatcagg
gtcgcggttttgtggcacgagctctggcacgaggggcttgaggaggcctcccggctgtac
tttggcgatcacaatatccaaggcatgttcgacgtacttgagccactccacgacctgctc
gagaaaggaccggtgacgctgcgggaaatctcattcacccagacatttggtcgcgaccta
agtgaggcacgtgaatggtgccgtcagtatcgccattcccaagacgtgaacgacatcagt
caagcgtgggatctctactatcaagtcttccggcgtattagccggcagctaccccagatg
acaagccttgaactaacatactgttcgcctgacctgcttcaggctcgtgacctcgagctt
gcagtacctggaacataccgtagcggacaagagattgtgcggatcaaggcctttgatgga
accctcagcgtcatcagctcaaaacagcgtccgcggaaagtcgtcattctcgggagcgat
ggcaaaacatacacattcctgctcaagggacacgaagacagccggcaggatgagcgtgtc
atgcagctcttcggcctgtgcaacactctcttggccaacgattcagagtgctacaagcgg
cacctcaacattcagcgctacccagcgattcctttgtcgcaaaactcgggcctctttggc
tgggttcccaacagtgacaccgttcaccaactcatccgggagtaccgtgaatcgagaaag
atcctcctcaacattgagcaccgaatcatgcttcagatggcaccagactacgataacctg
acgctgatgcagaaggtcgaggtgtttggatatgcgctggacaacacgacgggtcaagac
ctataccgggttctctggcttaaaagcaagagctccgaggcctggctggaccggagaaca
aactatacacgctccttgggcgtcatgtccatggttgggtatattctgggtctgggagac
aggcaccctagtaatctgatgctggaccggatcacaggcaagatcatccacatcgacttc
ggcgattgcttcgaagtggccatgaagcgggagaagtacccggagagggtgcccttcaga
ctcactcgcatgcttacctatgctatggaggttagcaacatcgagggcagtttccgcatt
acatgcgagcatgtgatgagagtcctgcgggataacaaggagagtgtcatggctgtcctg
gaagctttcatccatgatccactcctcacatggcgccttacgaatcctgccagtccggct
ggacctcacttcaactcggaacgagaacaagcgattgctggaccacaggcagggcgcgcg
cgtcggccatcgattctcgacggtcccgtggctcctacagagttccttgctgcccagggc
gccgcggcggatggcatgatggccccaccaccaggggcccggggcagagcaaggactaac
tcctctgctgtagcaccgggcagtctggcaaacggcaacggggccaacgacatggctgaa
gtgcaaaatgcacgagcagttgaggtgctcgacagagtcacccagaagctcaccggccgt
gacttcaaaccacatgaggagctcaccgtcaatgagcaggtcaacaagcttatcattgag
gccaccaagctggagaacctctgccaacattacattggatggtgtagtttctggtga

DBGET integrated database retrieval system