KEGG   Myceliophthora thermophila: MYCTH_2307780Help
Entry
MYCTH_2307780     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2307780
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2307780
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCTH_2307780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(4581355..4581382,4581442..4581509,4581562..4583678,4583747..4583885)
Genome map
AA seq 783 aa AA seqDB search
MVCSHIGPANLAKPTAADSVYREDCTQCFDSIDDPAGLDVCLKCFNGGCAGDRHHAKLHS
SARKHPLVLNIRRTRKMVVRDEPPPKMSKLAIAAETEADRYDTALKVKCLECGIDDIDKS
DPTIAATVDAIMKANTFSRKEEVKAWEQELTTCEHILTLQQEPPRQIESQDLGHCSNCDL
NQNLWLCLECGNLGCGRAQFGGVGGNSHALAHSKESSHGVAVKLGSITPEGTADVYCYAC
DEERIDDNLGAHLANWGIILAERQKTEKSLTEMQIEQNLRWEFSMTTDDGKELTPLFGPG
LTGLKNLGNSCYLASILQCLFDMPSFRQRYGGGVESPPDVLDPAQDLETQLRKIGDGLLS
GRYSKPDPDVIASEHSPEVPHQKGLQPSMLKHLIGRGHAEFSTMRQQDAFELLQHLVKLI
TRSQHPAGLGDPTRAMRFVMEQRLQCLGCKKVRYSSTEQDSIFIDVPLEKLPAEEGQEPK
YKPVNFKECLDTLTAPEMVELTCSACGSRDGFSKRQLFKTFPEVLVVNARKMAVVNWVPV
KVDVPVLVGEEPFPLDPYLSKGQQPDEELLPEEPATSNVPAFVPNQEALAMLEGMGFPRV
RCEKALHATGNADANAAMEWLFGHMDDPDIDTPLDLGGSVGNAGYTPDPEKLAMLESMGL
GGPRATKALKETNGDVERAIEWLFSHPDDSGEIEIEEAAGDGGEGAKKGAVEAGSSTLPV
NFQLQSIVCHKGTSIHTGHYVAFIRKKLGDETSWVLFNDEKVVKVVDVEEMKKFAYVYFF
RRV
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggtttgctcgcacatcggaccggccaacctggccaagccgacagccgccgattcggtg
taccgcgaggactgcacccagtgcttcgattccatcgatgatcccgctgggcttgatgta
tgcctcaagtgcttcaacggcggctgcgcaggtgaccgccaccatgcaaagctacacagc
agcgcccggaaacatcccctagtcctcaacatccgccgcacgcggaagatggttgtcagg
gacgagcccccgccgaagatgtccaagcttgccattgccgccgagactgaagccgaccgc
tacgacacggcgctgaaggtcaagtgcctcgagtgcgggatcgacgacatcgacaagagc
gaccccacgatcgctgcgacggtggacgccatcatgaaggccaatacattttcgcggaaa
gaggaggtcaaggcgtgggagcaggagctgaccacctgtgaacacattcttacgctgcag
caagaacctccccggcaaatcgagtcacaggacctaggccactgctccaactgcgacttg
aaccagaatctctggctttgcctcgagtgtggtaaccttggttgcgggcgggcgcagttt
ggcggagtgggcggaaactcgcatgccctcgctcactctaaggagtcctcacacggagtg
gccgtcaagctgggttcgatcacgcccgaggggaccgccgacgtgtactgttatgcttgc
gatgaagagcggatagatgataacctgggtgcccatctcgccaactggggcatcatcctg
gccgagcggcagaagacggaaaagagcttgaccgagatgcagatcgagcagaacctacgg
tgggagttctccatgacaacagacgacggcaaagagttgaccccgctcttcggacccggc
ctgacaggtctcaagaaccttggtaacagctgctacctcgccagtatccttcagtgcctc
tttgacatgccgtccttccggcaacggtacggtggtggcgttgagtcccccccggacgtg
ctagatcctgcccaggacctggagactcagctgcgcaagattggggacggcctgctctct
ggtcggtactccaagccggatccggatgtgattgcttcggagcactctcccgaggtcccg
catcagaagggtcttcagccatccatgctaaaacacctcatcggccgcgggcacgccgag
ttctcaaccatgcggcagcaagacgcctttgagcttctccagcacctcgtcaaactcatc
accaggtcccagcacccggccggcctcggcgaccccacgcgggccatgcgcttcgtgatg
gagcagcggctgcagtgcctggggtgcaagaaggtgcggtacagcagcacggagcaggac
agcatcttcatcgacgtcccgctcgagaagctcccggcggaggagggccaagagcccaag
tacaagccggtcaacttcaaggagtgtctcgataccctgacggctcccgagatggtcgag
ttgacatgctcggcgtgcgggagcagggacggtttcagcaagcggcagctcttcaagacc
tttccagaggtgctggttgtcaatgcgcgcaagatggccgtggtgaactgggtccccgtc
aaggtggacgtgccggttctggttggagaagaaccctttcctctggatccgtatctctcc
aagggacagcagcccgacgaggaattgttgccggaggagccggccacgagcaacgtgccg
gcgtttgtgccgaaccaggaagcgctcgccatgctggaaggcatgggattcccaagggtc
cggtgcgaaaaggcgctccacgcaacaggaaacgcggatgcgaatgcggcgatggagtgg
ctgtttggccacatggatgatccggacatcgacacccccctcgacctcgggggtagtgtt
ggcaacgccggatacacgcccgacccggagaagctcgctatgctcgagtcgatggggctg
ggcgggccgcgcgcgaccaaggcgctcaaggaaaccaacggggacgttgagcgggcgatc
gagtggctgttcagccaccccgacgactcgggcgagatcgagattgaggaggcggccggt
gacggtggggagggtgcgaagaagggcgcggtcgaggcaggtagcagcacgctgccggtc
aacttccaactgcagtccattgtgtgccacaagggaacgagcattcacaccggacactac
gtggcattcatccgcaagaagctcggtgacgagacatcgtgggtgctcttcaatgacgag
aaggtggtcaaggtggtggatgtggaggaaatgaagaaatttgcctatgtctacttcttc
cggcgagtttga

DBGET integrated database retrieval system