KEGG   Myceliophthora thermophila: MYCTH_2308296Help
Entry
MYCTH_2308296     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mtm  Myceliophthora thermophila
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MYCTH_2308296
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MYCTH_2308296
Peptidases [BR:mtm01002]
 Metallo Peptidases
  Family M67
   MYCTH_2308296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(1477426..1477609,1477711..1479056,1479121..1479258))
Genome map
AA seq 555 aa AA seqDB search
MNVTDLSMGSRPMNAKELTDKAKNFDWNPRIGFKYWARAAETIYHEGQVYLREGNVPKAY
LVLFRFSTLVLEYLVKHPEAKEPESKRALKPLQRRIPRVIEQLETLRPEIDDTYDRWMRI
TAAQRDTLRSGEPFPAASSSTYAKHAANDPALSWSYASPANILDVQDHQDLAVDLAKKEM
RRRRQASGLVGEDYGRRDSVQRGGQDRETGTIRLVPQDMDDDELRRQMEATRRQLDRSDD
YARGYDDEDYIRPSTYYYPSITKSSPLKYERPVSRGRPEGPRLQPPRPPKERHVDRAPIE
PPPRPDKDLYLERESPPIGPPPRPDKEPLALVTPPYSSRPSEERPAIPSKLNAEPAPQKR
ITFRPAGYLENGDPIRPVFLPSTLRHKFLKLAADNTRRGLEMCGVLCGTTVNNALFISHL
VIPEQRCTPDTCETENESVMLDYCITNDLLVIGWIHTHPTQTCFMSSRDLHTQAGYQVMM
PESIAIVCAPKYEPSWGIFRLTNPPGLPHILSCQRTETFHQHSVDNLYVEAGSPQGHVYE
SKALEFEVCDLRPGH
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttacagacctgagcatgggcagccggcccatgaatgcaaaagagttgaccgac
aaggcaaagaacttcgactggaacccacgcatcggcttcaagtactgggcgcgcgccgcc
gagaccatctaccatgagggacaagtctatctgcgcgagggtaatgtacccaaggcatat
ctcgttctctttcggttctcgacccttgtcctcgaatacctcgtcaagcaccccgaggcc
aaagagcccgagtccaaacgagcccttaaacccctacaaaggcgcattccacgcgtgata
gaacaactcgagaccctgcgccctgagatcgacgatacctatgaccgctggatgaggatc
acggctgcccaacgggacacactaagaagtggggaaccattcccggccgcctcatcgtca
acgtatgcaaaacatgctgcgaacgatccagcgctgtcctggagttatgcttccccggcc
aacatcctcgacgtgcaggaccaccaggatcttgcggtcgacctcgctaagaaggagatg
agaaggcgaaggcaagcctccgggctagtgggcgaagactatgggcggagagactctgta
caacgtggggggcaggacagggaaacgggcactatccggcttgtgccacaggatatggac
gacgatgagctacgaaggcaaatggaagccacgcggcggcagctagatcgatctgacgac
tacgcaaggggctacgatgacgaggactacatccggccgtcgacatattattatccttca
atcaccaagtcatctccactcaagtacgagagaccggtctctcgggggcgcccagaaggc
ccgagactccagcctccgcggccacccaaagagagacacgtcgatcgagcaccgatcgag
ccaccacctcgacccgacaaggatctctacctcgagcgggagtcaccgcccatcggtccc
ccgccccggccggataaggaaccgttggccttggtgacgccgccgtactctagccgacct
agtgaagagagaccggctatcccttcaaaactaaacgccgaaccagccccgcagaagagg
atcaccttccgccccgccggctaccttgagaacggcgatccgataagacccgtcttcctc
cccagcactctacggcacaagtttttgaagctcgcagcggacaacacgcgtcgagggctg
gagatgtgcggcgtgctctgcggcacgacggttaacaacgcgctcttcatctcacacctg
gtgatcccggagcagaggtgcactcccgacacgtgcgagacggagaacgagtcggtcatg
ctggactactgcatcaccaacgacctgctggtgattggctggatccacacccacccgacc
cagacctgcttcatgagctcccgcgacttgcacacccaagcggggtaccaggtgatgatg
ccggagagcatcgccatcgtctgcgcgccgaagtacgagccatcatggggcatcttccgg
cttaccaatccgccaggcctccctcacattctgtcctgccagcgaaccgagacgttccac
caacactcggtcgataacctctatgtcgaggctgggagcccgcagggtcacgtttacgag
tcgaaggccctcgagttcgaggtctgcgacttgcgcccggggcactag

DBGET integrated database retrieval system