KEGG   Myceliophthora thermophila: MYCTH_2308782Help
Entry
MYCTH_2308782     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2308782
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2308782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(2588700..2590504,2590563..2591007,2591063..2592220))
Genome map
AA seq 1135 aa AA seqDB search
MSRPSTQSSVLGRFRYVCTLCGIVVSLDISLPRLRPEWLKMISDEDRIRKSLKAAREEDP
QRYADVGTEKETHYRTTALHTLNQYIKNILEESGTGPRKRISFRNKTFQVQFGRDCDEIF
RYLGFEEDHDANTNESYWIPPRLPPPEGKTPIGSSRAFYEDVRSEVQSVFAGKPPAQGEP
TVMPVSPAPRDELEKVLGCDKSRRCFSTLPVIENEARHFATLGAPVDADDALLKFAYSRQ
AELDPENTSTYLEALGTLAGRRSEELQMFVFTHQELLARQQKEAAAGGPNASPVEKAYAH
FGLTKSCPEDPAFFIGVYRTYRDQSPAQKSDHRLALLQIANDRQSDEIRNEVFGKPMDLQ
EACQFLRVEPGWPMDSIAVMAQSISSDSDMDQLDLLLLALDAISLSRGTDDPNRPEFESV
LAELRSIRRSQLTSSGTEHVGAAVSASDHASDAVDLELPVGLANLRNTCYLNSILQYFYS
VNAVRDLALNTDFPALEPTEANLSNLLRTDSSSNTGHDQRRTDLETGRAFVGHEFARELS
TLFRSLNASAENSITPRQRLANAALLRPEKLRPQSADPTAVPGASNDDAPPLPPRIAKGA
VTEAKDTPMAGVEQSDAASSGSSETLVDQSSGESPLIFALEEEDLKEKAAAAAVTSAAGG
SNRPASEPQTISRTSEPEVKMSKLTVEELAVELDKPNVGSDQMDVDEVMGNAIDHLRAAF
KVSTVGNSAAPPDPIEQAFFSTFIDNRKKIGDSEWNRTTRSDRWVTAYPAQSGTLDLYDA
LANSFDIEPLPGNLLSFTTIERPAPHFHVCIQRSDGVRKNSNPITIPETLYLDRFMHTAE
TQSSLFKRRKRKWDIKTRLSEMVTPAKKRLETAKQQSQIGGRPSKAGAQDDGLTEEEIDG
FLVLGGLDTRYQIPSSSMVDGVGVSNDEPETQSFFALDPDLKRLANKYGVEEPDLSLTVA
ADPPPKSDATTTFPPSDLDEFWERFAAEEAEEKERLITERDRLFSDAQNVAYRLHAVVCH
AGSSASAGHYWVWIHDFERDVWRKYNDTTVSVHPAEFVFGELNTKGEPYYLAYVKADEVQ
NLVSIPRRQPQAPPPVPPRPRSSLGAVKADGEDNVMASIEHWEDVEMLPPPYSNP
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggccgtccacacagagctctgttttgggcaggtttcggtatgtctgcaccctt
tgtggcattgtcgttagcctggatatctctctgccccggctgaggccggagtggttgaag
atgatctcagatgaggacaggatcaggaagtccctcaaggccgccagggaggaagaccca
cagcgttatgcagatgtcggcacagagaaggagacacattataggacaacagctctccac
accttgaatcagtatatcaagaatatactggaagagagcggtacagggccccgtaaaagg
atctcgttccggaacaagacattccaggtccagtttggccgggattgcgacgagattttc
cgatatctcggttttgaggaggaccacgacgcaaataccaacgagtcatactggatccct
ccgcgattaccgccccccgagggcaaaacaccaatcggatcctctagggccttctacgag
gatgtgaggtccgaagtgcagagcgtctttgctggtaaaccacctgcgcagggcgagcca
acggtcatgcccgtctcaccggcaccccgcgacgaactcgagaaggtgctggggtgtgac
aagagccgccgctgttttagcaccctccccgtgatcgaaaatgaggcccgacactttgcc
acgctcggtgccccggtcgatgccgacgatgcccttctcaagttcgcgtacagtcggcag
gcggagttggacccggaaaatacctcgacctacttggaagcgctcggcaccctcgccggt
cgccggtccgaggaactccagatgtttgtcttcactcaccaggagttgctcgcaagacag
caaaaggaggccgccgccggagggcccaacgcgagcccggttgagaaagcgtacgctcat
ttcggcctcaccaagtcctgccctgaggatcctgcctttttcattggcgtgtacaggacc
tatagggaccagtctcctgcgcagaagtccgaccaccgactcgccctgctccagatcgcc
aacgaccgccaaagtgatgagatcaggaacgaggtctttggaaagccgatggatttgcag
gaagcttgtcagtttctccgcgtggaaccgggatggccaatggacagcattgcagtcatg
gcacaaagtatatcctccgactcggacatggatcaactagatcttctccttcttgctctc
gatgcgatctcgctctcccggggaacggacgacccgaaccgtcctgagttcgagagcgtc
ttggccgagctacggtccattcggcggtctcaactaacttcttccggcactgagcacgtc
ggcgctgcggtctcagcgtccgaccacgctagtgacgctgtggatctggagctgccggtc
gggctggccaaccttcgcaacacgtgttacctcaatagcatactgcaatatttctactct
gtgaatgccgtcagggatctggcattgaacacggacttccctgccctagaaccgaccgaa
gcgaatctcagcaatcttttacgtacggatagcagcagcaacaccggccatgatcagagg
cggactgatttggagaccggtcgagccttcgttggccacgagttcgcgcgtgagctgagc
accctattccgttccctaaatgcttctgcggaaaactcgatcacgcctcgccaacgtctt
gccaacgctgccttgttgaggcccgagaagctccgtccacagtcagcagatcccacagct
gtcccaggtgcaagcaacgatgatgcgccgccgctgccgccgcgtatagccaagggtgct
gtcacagaagccaaagacacgcccatggcaggagttgaacaatccgacgccgcaagttcc
ggaagctcggagacgctggtcgatcaatccagcggagaaagtcctctaatttttgcactc
gaggaggaggatttgaaggagaaagctgctgcggccgcagtgacatcggcagcaggtggc
tccaacagaccagcaagcgaaccgcagactatcagccgaacgagtgaacctgaggtgaaa
atgtcgaagctcaccgttgaggagctcgccgtagaactcgacaagcctaatgttgggtcc
gaccagatggacgttgacgaggtcatggggaatgccatcgaccacctgcgagccgccttc
aaggtttccaccgtcggcaattctgcagccccgccagatcccatcgagcaggctttcttc
tcaaccttcatcgacaaccgcaagaagatcggtgactcggaatggaaccggaccaccagg
tctgatcgctgggttacagcgtatcctgctcaatccgggacgttggacctgtacgatgct
ttggccaactcgttcgacattgagcccctaccgggcaacctcttatctttcaccaccatc
gaacggcccgcgccgcattttcacgtatgtatccagcgatccgacggcgttcggaagaac
tccaaccccatcaccatacccgagacattgtatctcgatcgattcatgcataccgccgag
actcaatcctctctcttcaaaaggagaaagaggaagtgggacatcaaaacaagattgagc
gaaatggtaacccctgcaaaaaagcgtctggaaacagcgaaacagcagtcgcagattgga
ggccgtccctcaaaggccggcgctcaggatgatgggctcactgaagaggagatcgatgga
tttctggtccttgggggtctggatacgcggtatcagattccatcctcgtctatggttgat
ggcgttggtgtctcgaatgacgaacccgagactcagagcttcttcgcccttgatccggac
ctaaagcggttggcgaataaatacggcgttgaagagcccgatctctctctgaccgtcgct
gcagacccgcccccaaagagcgatgcaaccacaacatttcccccgtcagacttggatgaa
ttttgggaaagatttgcggccgaggaggctgaagagaaggagcgtctgattaccgagcga
gacagactcttcagcgatgctcaaaacgtcgcttaccgcctccatgcagtggtgtgccac
gcaggatcttctgcctctgccgggcactattgggtatggatccatgactttgagcgagat
gtttggcggaagtacaacgacaccacggtttcggtgcacccagccgagttcgtcttcggg
gagctcaacaccaaaggtgagccctactacctcgcatatgtcaaggccgacgaggtccag
aatctcgtcagtataccacgccgtcaaccgcaagctccgccacctgtgccaccgcggccg
aggtcgagtctgggtgccgtcaaggccgacggggaagacaatgtcatggctagcattgag
cactgggaagacgtggagatgctgccgcctccgtactcaaacccttag

DBGET integrated database retrieval system