KEGG   Myceliophthora thermophila: MYCTH_2308932Help
Entry
MYCTH_2308932     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCTH_2308932
Translation factors [BR:mtm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MYCTH_2308932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(2938461..2938732,2938803..2940339,2940403..2940831)
Genome map
AA seq 745 aa AA seqDB search
MAPSFDHLREEDLDEEDFDMDEVDISDLREKYEVQLEQGYDTFVVIDGLPAVTEEQKPKL
IKFLLKKLNTVGRTSEDAIYMPMGDDGMSLRFAFVEYSSPAEAAAAVRQLDFVPLDKKHT
LRVNKLTDIDRYGREGRIDEEYKPPKIEPFQEKEHLRSFMADPSGRGRDQFVMFRGDTVG
VFWNNEKDEPENIVDRQQWTETFVQWSPMGTYLTSVHAQGVLLWGGASWSRLRRFPHPFV
NLIAFSPNEKYLVTWSNRPISIPDSGHPALSLDDDGKNYVIWDIETAKPLRSFAQQDTTG
DDPVAKKAAKFPWPAFKWSADDKYVARLNQGTSISVYELPKMNLLDKTAIKIEGVMDFEW
APATPRRDGVKTYEQLFCFWTPEIGSNPARVGLMSIPSKQIVRSLNLFSVSDVKLHWQSD
AAYICVKVDRHSKSKKSQATTLEIFRVREKGVPVEVVDTIKDTVINFAWEPKGDRFVIIT
TTEPVGATAVPPKTAVSFFCPEKAKGNAVGNFKHLRTLDKKNSNAIYWSPKGRFVVVATI
HNAQSSDLDFFDVDFEGDKPESEKDLTANLQLMNTSEHYGITDVEWDPSGRYVATWASVW
KHAMENGYHLYDFKGELLREEVIEKFKQWAWRPRPPTLLTKEEQKQIRKNLREYSRIFEQ
EDAERISSADVAVVEARRRLLQQWYAWRQSVEEELAEERAALGLPEKPVAELLKEKAAAA
APAGEEQVVEEVMEEVLEETEEIVN
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtcgttcgaccacttgcgcgaggaggacctcgacgaggaagactttgacatg
gatgaagtcgacatctcggatctccgcgaaaaatatgaggttcagcttgagcagggctat
gacacctttgtcgtcatcgacgggttgcccgctgtcaccgaagagcaaaaacccaagctt
atcaagttcctcctcaagaaactcaacacggtcggcaggaccagcgaggacgcgatctac
atgcccatgggcgatgatggcatgtcgctgaggttcgcctttgtcgaatactcgtcgccc
gccgaagctgccgcggctgtgcggcagctcgattttgttcccctcgacaagaagcacacc
ctgcgcgtcaacaagctcaccgatatcgaccggtacggacgggaaggccgtatcgatgag
gagtacaagcccccaaagatcgagccgtttcaagagaaggagcacctccggtccttcatg
gcggacccgagcgggcgcggcagggaccagttcgtcatgttcaggggggacactgtgggc
gtcttctggaacaacgagaaggacgagccggaaaacattgtggaccggcaacagtggacc
gagaccttcgttcagtggtcgcctatggggacatacctcacatcagtgcatgcgcagggc
gtactactctggggtggcgcttcttggtcgaggctgaggcgattccctcaccctttcgtc
aacctgattgccttctcgcccaacgaaaaatacctggtcacttggtcgaaccgcccgatt
tcgattccggacagcggccaccctgccctctcgctcgacgatgatggcaagaactacgtc
atctgggacattgagaccgcaaagcccttacggtcatttgcgcagcaggatacaaccggg
gacgatccggtcgcgaagaaggctgccaagttcccctggcccgctttcaagtggtccgct
gatgacaagtacgtggcgaggctgaaccagggcacctccatttccgtgtacgagctccca
aagatgaatctcctggacaagactgcgatcaagattgagggcgtcatggactttgagtgg
gcgcccgccactccacgccgggacggtgtcaagacgtacgagcaactgttctgcttctgg
acgcccgaaattggcagcaacccagcgagagtcggtctcatgagcatcccttccaagcag
attgtccgttccctcaacctctttagcgtgtccgatgtcaagctccactggcaatccgat
gcggcgtacatctgtgtcaaggtcgaccggcattccaagtccaagaagtcgcaggctact
accctggagatcttccgcgtccgggaaaagggcgtccctgttgaggtcgttgacactatt
aaggacacggtcatcaactttgcttgggagcccaagggtgaccggttcgtgatcatcacc
acaaccgagccggtcggcgccaccgcggtgccgcccaagacggccgtttccttcttctgc
ccagagaaggccaagggcaacgcggtgggcaatttcaagcacctgcggacactggacaag
aagaacagcaatgccatctactggtcaccaaagggccgctttgttgtcgtggccacaatc
cacaacgctcagagctccgacctcgatttcttcgatgtcgactttgaaggtgacaagccg
gagagtgagaaggacctcacggcgaatctgcagctcatgaacacctcggagcactacggc
attaccgatgtcgagtgggatccttcaggccgctatgtcgccacctgggcgtcggtgtgg
aagcacgcgatggagaacggctaccacctatacgacttcaagggcgaactgctgcgcgag
gaggtgatcgagaagttcaagcaatgggcgtggcgcccccgccctccgactttgctcacc
aaggaggagcaaaagcaaatccgcaagaacttgcgtgagtactcgcgcatctttgaacaa
gaggatgccgagcgcatcagcagcgcggacgtcgccgtggtcgaggcccgccgccgcctg
ctacagcagtggtacgcctggcgccagagcgtggaggaagagctggccgaggagcgcgcc
gctctgggtctgcccgagaagcccgtggccgagttgctcaaggagaaggcggcggccgcg
gcacccgctggcgaggagcaggtcgtcgaagaggtcatggaagaggtgctggaggaaacg
gaggagattgtcaactaa

DBGET integrated database retrieval system