KEGG   Myceliophthora thermophila: MYCTH_2309283Help
Entry
MYCTH_2309283     CDS       T02231                                 

Definition
ubiquitin carboxyl-terminal hydrolase-like protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2309283
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2309283
Transcription machinery [BR:mtm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MYCTH_2309283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3421598..3421699,3421787..3422035,3422128..3422909,3422979..3423089,3423148..3423384,3423445..3423529))
Genome map
AA seq 521 aa AA seqDB search
MSARPATPASPKNYKVKSPQPGQPMYGCEHLQRLFNQDQATTNTSIQHYKAILRSIFDTN
PLVPQTSKAADGIVITSLTPTYLCLQCPSTLTEDDRTKHGSKKSHRFYVDSKSGALYCQM
CDDIVWDPTFEELRLKKIGTGTFSSRKRKHEELFETSDPVRDNPTYITSNTTIASCKSSG
LRGIYNAGATCYQNVVLQSFLHNPILRNYYLSDGHSSSTCNVPYCLSCAMDDMFQDFYAL
ETTNGYTAANILSGFWFSDRRAFDNLVTTKEQDAHEFFQFLAEELHERNGDGKKPETGSE
HSCNCIIHQTFYGKLQSTTTCQNCSGVTHQVQSFLDLNLPLENLSHKKGKKTTSRGQLTL
QECLEEEYVKSDKCEYRCNNCSSMQQARRQTTIKRLPNVLSIQLKRFEYKQGRNERAAKI
DTPVQFPLELNMLPYTNRGRTISSNGHDGGKENYELARSCTYDLLSVVVHVGEIDTGHYV
SYCRVGDQWFAFNDHRVELAQKSDVLNSKAYLLFYIVRSLS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgaggccagctacaccggcttcgccgaagaactacaaagtcaagtcgcctcaa
ccagggcagcccatgtacgggtgtgaacacctccagagactcttcaaccaggaccaagcg
accacgaacacctccattcaacactacaaggcgatcctgcggagcatcttcgatacaaac
cccctggtcccgcagacctccaaggccgccgacggcattgtcattacttcgctcactccc
acatacctttgcctccaatgcccctcgaccctcaccgaggacgataggaccaagcatggc
agcaagaagtcgcacagattctatgttgactcaaagagcggtgctctgtactgccaaatg
tgtgatgacatcgtttgggatcctacctttgaggagctgaggttgaagaagatcggaaca
gggaccttttcgagtcgaaaacgcaagcacgaggagctttttgagacgtcggatcccgtt
cgggacaacccgacgtacatcacgtcgaatacaaccatagcgtcgtgcaaatccagcggc
ctccggggcatctacaatgccggcgccacctgctaccagaacgttgtcctccagagcttc
cttcacaaccccattctccgcaactactacctcagcgacggccactccagcagcacctgc
aacgtgccatattgcctgagctgtgccatggacgatatgtttcaggacttctacgcgttg
gaaaccaccaacggatatacggcagccaacatcctctccgggttctggtttagcgacagg
agggcgttcgacaacctggtgacgaccaaggagcaggatgcccacgagttcttccagttc
ctcgccgaggaactgcacgagcgcaacggtgacggcaagaagcccgagactgggagcgag
cacagttgcaactgcatcatccaccaaacattctacggcaagctgcagagcaccacgacc
tgccaaaactgtagcggcgtgacccaccaagtacagagcttcttggatctcaacctcccg
ctggagaacctgtcccataaaaagggcaagaagaccacatcaagagggcagctgacgttg
caggagtgtcttgaggaggagtacgtcaagtcggacaagtgcgagtaccgctgcaataac
tgcagctcgatgcagcaggcgcgccggcaaacgaccatcaagcggctaccgaatgtgctg
tcgattcagcttaaacgattcgagtataagcaaggccgcaatgaacgtgccgccaagatt
gacacgcccgttcagtttccgctcgagctcaacatgcttccctacaccaaccgcggccgc
accatcagcagcaacggccacgacggtggcaaggagaactacgagctggcgcgctcctgt
acctacgatctgctcagcgtggtcgtgcacgtgggcgagatcgacacgggccactacgtg
tcgtactgccgggttggcgaccagtggtttgccttcaacgaccaccgggtagaacttgcg
cagaagtcggacgtgctcaattccaaagcctacttacttttttatatcgtcaggtcgttg
tcctga

DBGET integrated database retrieval system