KEGG   Myceliophthora thermophila: MYCTH_2309306Help
Entry
MYCTH_2309306     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2309306
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MYCTH_2309306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(<3440624..3440898,3440952..3441133,3441190..3441286,3441347..3441441,3441493..3441807))
Genome map
AA seq 321 aa AA seqDB search
MASAQVVNNSTGETALESGEAASSLPVRRSGRARKRPSGHGEDSDYKNGKVAASPVSSDS
RRNPKRRAAPDAFNVPEHLLEASLGPWKENEQSEWPSWVELESDPAFFTAIMGLLGVKGA
RIEEVLSVDEDTLATLPPPVHGLVFLYEYVADQSPEVTYPGHDVWFANQTTHNACATIAL
LNIIMNAERLSLGEKLRHFKQESKDLSPPLRGNMINNSTWIRVAHNSFARRLDLLDAALS
LQNEVDNKEKRARSSAAMQRRRKKKPKKERVKAGKSGDTPAYHFIAFVPVGQQVWQLDGL
SSAPVCIGKSLSSMSFSSPAL
NT seq 964 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggcgcaggtcgtgaacaactccaccggggaaacggctcttgagagtggtgaa
gcggcgtcttctctccccgttcgtcggtccggccgcgcacgcaagaggccttccggccat
ggtgaggattccgactacaaaaacgggaaggtagcggcctcgcctgtctcatcggattcc
cggcgcaacccaaagcgacgggcggccccggacgctttcaacgtgcccgagcacctgctc
gaggcatctctaggaccgtggaaggagaatgagcagtctgagtggccaagttgggtcgaa
ttggaatctgacccagcatttttcacggctataatgggtctgcttggcgtcaagggagca
agaatagaggaagtgctctcggtcgatgaagataccctggccactctgccacctccagta
catggactggtatttttatacgagtatgtcgccgaccagagccctgaggtcacctacccg
ggccacgatgtgtggttcgcaaatcagaccacacataacgcctgtgccaccattgccttg
ctcaacatcatcatgaacgcagagcgactgagtcttggtgagaagctccgccatttcaag
caggaatccaaggacctgtcgccaccacttaggggaaatatgatcaacaacagcacctgg
atacgagttgcccacaactctttcgctcgacggttagatcttcttgacgccgcgctcagt
ctccagaacgaggtcgataacaaggaaaagagggcgagatcatcagctgccatgcagcgg
cggagaaagaaaaagcccaagaaagaaagggtcaaagctggcaaatccggcgatactccc
gcctatcacttcatcgcctttgtgccagtcggacaacaagtctggcaactcgacggcctc
tcgtcggcgcccgtctgcattggcaagtcactgtcttctatgtctttctcttcgccggca
ctaa

DBGET integrated database retrieval system