KEGG   Thermothelomyces thermophila: MYCTH_2309375Help
Entry
MYCTH_2309375     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00220  Arginine biosynthesis
mtm00330  Arginine and proline metabolism
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01230  Biosynthesis of amino acids
Module
mtm_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MYCTH_2309375
   00330 Arginine and proline metabolism
    MYCTH_2309375
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MYCTH_2309375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 11511272
NCBI-ProteinID: XP_003665512
JGI: 2309375
UniProt: G2QI78
Position
5:complement(join(3545439..3545751,3545823..3546595))
Genome map
AA seq 361 aa AA seqDB search
MSPSRVSGDFNESASATQQSCTTTKQPAPRHFGRLDNTSMIESKFLSQPQDLGIVAVGFS
GGQPKPGVDAAPAALIESGLLTQLRDDLGYRLHGHDAVHSFSDVVPAQDPPHRGMKNPRA
VSAVTRRIAEQVYRHAKEGRLVLTLGGDHSIAIGTIAGTAKATRERIGRDIAVIWVDAHA
DINTPETSGSGNVHGMPVSFLTGLARDDKEEFFGWLTDEHRVSVKKLVYIGLRDVDAGEK
RILRENGIKAFSMFDIDKHGIGRVMEMALAHIGNDTPIHLSFDVDALDPMWAPSTGTPVR
GGLTLREGDFICESVHQTGSLVAVDLVEVNPRLAADTDLGAHETVRAGCSLVRCALGESL
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctcccgtgtcagcggcgatttcaacgaaagcgcatcggcgacgcagcaatcc
tgcaccaccaccaagcagcccgccccacgccacttcggcaggctggacaacacgtccatg
atcgaatccaagttcctgtcgcagccccaggacctggggatcgtcgcggtcggtttctcg
ggcgggcagcccaagccgggagtcgacgcggcgcccgctgcgctgatcgagtcgggcctg
ctgacacagctgcgcgacgacctcggctacaggctgcacggccatgacgccgtgcattcg
ttctccgacgtcgtgccggcgcaggacccgccccaccgcggcatgaagaacccccgcgcc
gtgtcggctgtcacgaggcgcatcgccgaacaggtctacaggcacgccaaggaaggcagg
ctggtgttgaccctgggcggggaccacagcatcgccatcggcaccatcgcggggaccgcc
aaggccaccagggagaggatcgggagggacattgcggtcatttgggtcgatgcgcacgcc
gacatcaacaccccggagacgagcggcagcggcaacgtgcacggaatgcccgtcagcttc
ctgaccggcctcgcgcgcgatgataaggaggagttctttggctggttgacggacgagcac
cgggtgagcgtcaagaagctggtgtacattgggttgcgggatgtggacgccggggagaag
cgtatcctgcgggagaatggcatcaaggcgttcagcatgtttgacatcgacaagcacggc
atcggtcgcgtcatggagatggcgctcgcgcacatcggcaacgacactccgatccacctc
tcgttcgatgtcgacgccctcgaccccatgtgggcgccgtcgaccggcacgccggtgcgt
gggggtctaaccctgcgcgagggcgacttcatctgcgagtcggtgcaccagaccggcagc
ctggtggcggtggacctcgtcgaggtcaacccccgcctggcggcagataccgacctgggc
gcccacgagaccgtccgagccggctgctccctcgtccgctgcgctctcggcgagagcctg
ctgtga

DBGET integrated database retrieval system