KEGG   Myceliophthora thermophila: MYCTH_2309375Help
Entry
MYCTH_2309375     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCTH_2309375
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYCTH_2309375
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MYCTH_2309375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(3545439..3545751,3545823..3546595))
Genome map
AA seq 361 aa AA seqDB search
MSPSRVSGDFNESASATQQSCTTTKQPAPRHFGRLDNTSMIESKFLSQPQDLGIVAVGFS
GGQPKPGVDAAPAALIESGLLTQLRDDLGYRLHGHDAVHSFSDVVPAQDPPHRGMKNPRA
VSAVTRRIAEQVYRHAKEGRLVLTLGGDHSIAIGTIAGTAKATRERIGRDIAVIWVDAHA
DINTPETSGSGNVHGMPVSFLTGLARDDKEEFFGWLTDEHRVSVKKLVYIGLRDVDAGEK
RILRENGIKAFSMFDIDKHGIGRVMEMALAHIGNDTPIHLSFDVDALDPMWAPSTGTPVR
GGLTLREGDFICESVHQTGSLVAVDLVEVNPRLAADTDLGAHETVRAGCSLVRCALGESL
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctccctcccgtgtcagcggcgatttcaacgaaagcgcatcggcgacgcagcaatcc
tgcaccaccaccaagcagcccgccccacgccacttcggcaggctggacaacacgtccatg
atcgaatccaagttcctgtcgcagccccaggacctggggatcgtcgcggtcggtttctcg
ggcgggcagcccaagccgggagtcgacgcggcgcccgctgcgctgatcgagtcgggcctg
ctgacacagctgcgcgacgacctcggctacaggctgcacggccatgacgccgtgcattcg
ttctccgacgtcgtgccggcgcaggacccgccccaccgcggcatgaagaacccccgcgcc
gtgtcggctgtcacgaggcgcatcgccgaacaggtctacaggcacgccaaggaaggcagg
ctggtgttgaccctgggcggggaccacagcatcgccatcggcaccatcgcggggaccgcc
aaggccaccagggagaggatcgggagggacattgcggtcatttgggtcgatgcgcacgcc
gacatcaacaccccggagacgagcggcagcggcaacgtgcacggaatgcccgtcagcttc
ctgaccggcctcgcgcgcgatgataaggaggagttctttggctggttgacggacgagcac
cgggtgagcgtcaagaagctggtgtacattgggttgcgggatgtggacgccggggagaag
cgtatcctgcgggagaatggcatcaaggcgttcagcatgtttgacatcgacaagcacggc
atcggtcgcgtcatggagatggcgctcgcgcacatcggcaacgacactccgatccacctc
tcgttcgatgtcgacgccctcgaccccatgtgggcgccgtcgaccggcacgccggtgcgt
gggggtctaaccctgcgcgagggcgacttcatctgcgagtcggtgcaccagaccggcagc
ctggtggcggtggacctcgtcgaggtcaacccccgcctggcggcagataccgacctgggc
gcccacgagaccgtccgagccggctgctccctcgtccgctgcgctctcggcgagagcctg
ctgtga

DBGET integrated database retrieval system