KEGG   Myceliophthora thermophila: MYCTH_2309838Help
Entry
MYCTH_2309838     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
mtm  Myceliophthora thermophila
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MYCTH_2309838
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MYCTH_2309838
Protein kinases [BR:mtm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   MYCTH_2309838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(426834..426915,426986..427169,427246..427324,427405..427761,427827..427926,427979..428022,428087..428216,428302..428349,428411..428466))
Genome map
AA seq 359 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYTDLQPVGMGAFGLVCSAKDQLTNQNVAVKKIMKPFSTPVL
AKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPRRERQPLKNKFKNADPPAIDLLERMLVFDPKKRITAAEALAHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEAASVGQMEDQQYLAQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgtgcgcgcccagatctttgggaccaccttcgagatcacgtcgaggtat
accgacctccagccggtcggcatgggagcattcggtctggtctgctctgcaaaggaccag
cttaccaaccagaatgtcgccgtcaaaaagattatgaagcctttcagtaccccggtcctg
gccaagaggacgtatcgcgagcttaagctgctcaagcacctgaagcacgagaacgtcatc
tcgctcagcgacatcttcatctcccccctcgaggacatttactttgtcacggagctcctg
ggcaccgacctgcacaggctactcacttcgaggcctctggagaagcagttcattcaatat
ttcctctatcagattatgcgcggtctgaaatacgtgcactcggccggcgtcgtccacagg
gacctgaagcccagtaacatcctcgtcaacgagaactgcgacctcaagatctgcgatttc
ggcctggcgcgcatccaggacccccagatgacgggctatgtgtccacgaggtactaccgc
gcgccagaaatcatgctcacgtggcaaaagtacgacgtcgaggtcgacatctggagcgcc
ggctgcatctttgccgagatgctcgagggcaagccgctcttccccggcaaggaccacgtc
aaccagttctccatcatcaccgagctcctcggcacgccgcctgacgatgtcatcaacacc
atcgcaagcgaaaataccctgagattcgtcaaatctctccccaggcgcgagaggcaacct
ctcaagaataaattcaagaacgccgatcctccggccatcgacctcctagagcgcatgctc
gtctttgaccccaagaagcggataacagcagcggaggcgctggcccacgaatacctggct
ccgtaccacgaccccaccgacgagcccgtagctgaggaaaagtttgattggagcttcaac
gacgccgacctgcccgtcgacacatggaagatcatgatgtactcggagatcctcgactac
cacaacgttgaggccgccagcgtcggccaaatggaggaccaacaatacctcgcacaatga

DBGET integrated database retrieval system