KEGG   Myceliophthora thermophila: MYCTH_2310028Help
Entry
MYCTH_2310028     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MYCTH_2310028
Enzymes [BR:mtm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MYCTH_2310028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(980482..980820,980885..982496,982549..982751))
Genome map
AA seq 717 aa AA seqDB search
MRVFDVTFLFGVAALVVAQSPTVDDDEEPPKETTYFNGKEVPPMLELTPSNWDKELKASK
YLMVKHYSPYCPHCIDYAPTFQTLYEFYYTSSPAGNAPKDASFTDFYDFRFADVNCVAYN
DLCTKNKVSSWPTTILYEDGEPIVTFKGVKAMKVLSSAIEDALEKAKPGTRPSAIELPEP
GAKSYPPSNDAAVDKPDPEGKRTPANPKDQPDKGAAPASTSLASEPATPESTSPKYLVVP
FDPPPQVVVKPTTTPNPNGESVPLTAETFQNLVTTTHDPWFIKFYAPWCHHCLKVKPTWD
ELAKEVKGRLNIGEVNCDAESRLCKDVGVRGYPTFLFFRSGEHVEYQGLRGLGDLIQFAE
QAIELASGVQDVDADSFKALEEKEKVIFLYFYDHAATSEDFIALERLPLNLIGRAKLVKT
RDVRLYERFKITTWPRLLVSREGRPTYYPPLTPRDMRETHLLMNWIRSVWLPLVPELTAS
NAREIMDGKIVVLGILNRENDESFQSALREMKSAANEWMDKQIQLFQLERQELRDAKQLR
IEEAEDRGDERAARNAKNIRINMDRSDRKEVTFAWVDGVFWQRWIRTTYGIDVKDGERVI
INDEDNRRYWDQTSTGNPIVPSRTSILETINKVTANPAKIKPKLTIGFFEKLIFDVKTSF
KEHPFLSSGCVLGIAFGCLSWLRGGIRRLRAGHFKLDDAPSNRAPLLGLSSDGSKVD
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtattcgacgtgacatttttgtttggcgtggccgcgctggtcgttgcccagtcg
ccaactgtggatgacgacgaggagccgccgaaggaaaccacatacttcaacggaaaagag
gtcccgccgatgctcgagctgacaccgagcaactgggacaaagagctgaaggcgtccaag
tacttgatggtcaagcattacagcccgtactgcccgcattgtatcgattatgctccgacg
ttccagacgttgtacgagttctactacacctcatctcccgccggaaacgcgcccaaggat
gccagttttaccgacttctatgatttccgatttgccgacgtgaactgcgtcgcatacaac
gacctttgcaccaagaacaaagtatcgtcatggccgactaccatcctatacgaggacggc
gagcctatcgtgaccttcaagggtgtcaaggccatgaaggtgttaagcagtgcaatcgag
gatgcgcttgagaaggctaagccgggaacgcgtccttccgcgatcgagctgccggaaccc
ggcgccaagtcatatcccccatccaacgacgcagcggttgacaagccggaccctgaaggg
aaacgcacacctgcaaatccaaaagaccaaccggataaaggggcggctcctgcgtcgacg
tcgcttgcgtcagagccagcgaccccagagtcaacgagccccaaatacctcgtggttccg
tttgacccgccccctcaggttgtggtgaagccgacgaccacgcctaaccccaatggtgaa
tcggttcccctgacggccgagactttccagaacttggtgaccacgacgcacgatccttgg
ttcatcaagttctacgctccttggtgtcaccactgcctgaaggtcaaaccaacctgggat
gaacttgcgaaagaggtcaagggcaggctcaacattggcgaggtcaactgcgacgccgaa
tcccggttgtgcaaggatgtcggcgtcaggggttaccccaccttcctgttcttcaggtcc
ggcgagcatgtcgagtaccagggccttcgcggcctgggcgaccttatccagttcgccgag
caggcaatcgagctggcgagtggcgtccaagacgtcgacgccgactcgttcaaggccctc
gaggagaaggagaaagtcatcttcctctacttctacgatcacgccgccacgtccgaggac
ttcatcgctctcgagcgtctgccgctgaacctgataggccgtgctaaactggtcaagacg
cgcgacgtcaggctgtatgagcggttcaagatcactacgtggccgcgactgctcgtctcg
cgtgaggggcgtcctacatactacccgccgctcaccccgagggacatgcgcgagacgcat
ttattgatgaactggatcaggtccgtgtggttaccgttggtgccggagctgacggcctcg
aacgcgcgcgagatcatggacggcaagattgtcgttcttggcatcctcaaccgggaaaac
gacgagtcgtttcagagcgcgctccgtgagatgaagagcgccgccaacgagtggatggac
aagcaaatccagctcttccagctcgagcggcaggagttgcgcgacgccaagcagctgcgg
atcgaggaagccgaggaccgcggcgacgagcgggcggctcgcaatgctaagaacatccgg
atcaacatggacaggtcggaccgcaaggaggttacttttgcgtgggtcgacggcgtcttc
tggcagcggtggatccgcactacatacggcattgatgtaaaggatggcgagagagtcatt
atcaacgacgaggataaccgccgttactgggaccaaaccagcaccggcaaccccatcgtc
ccgtcgcgcacctcaatcctggagaccatcaacaaggtcacggccaatccggccaagatc
aagccgaagctcaccatcggcttcttcgagaagctcatctttgacgtcaagaccagcttc
aaggagcacccgttcctcagctcgggctgcgtcctcggcattgcctttggctgtctctcg
tggttacgcggcgggataaggagattgagggccggccactttaagctcgacgacgctcct
agcaacagggcgccgcttctggggctgtcctccgacggcagcaaggtggactag

DBGET integrated database retrieval system