KEGG   Myceliophthora thermophila: MYCTH_2310394Help
Entry
MYCTH_2310394     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mtm  Myceliophthora thermophila
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYCTH_2310394
  Lipid metabolism
   00062 Fatty acid elongation
    MYCTH_2310394
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MYCTH_2310394
Lipid biosynthesis proteins [BR:mtm01004]
 Fatty acid synthase
  Component type
   MYCTH_2310394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(1761335..1762194,1762258..1762396))
Genome map
AA seq 332 aa AA seqDB search
MAIVKGVKLLVLGSLIATSIAKSLERRFESGDDDDDDTPLPLVIWHGLGDTYESEGMRRV
AEIAEEVNPGTLVYPIRVEENPSRDRYASFVGNLTDHVAKVCADIAAHPILSTAPAIDAL
GFSQGGQFLRAYVERCNKPPVRSLITFGSQHNGITAFRDCKPTDWICRIAMAVLKGDAWT
DTVQNKLVPAQYYRNPDEYEKYLEHSNFLADINNEREIKNEEYKKNIAKLENFVMYMFEE
DTTVIPKETAWFEDVNGTESTPLRARQLYTEDWLGLRALDRKGGLKFRTAPGDHMQLSEE
LLKEAFGDFYGPLNLHRGRSDPRPANWRSDDL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgtcaaaggagtgaagctgctcgtcctcgggtcgctcattgcgacgtcgatc
gcgaagtctttagagcgccgattcgagagcggcgacgatgacgacgatgacaccccgctg
ccgctggtcatttggcatggcctaggcgacacctacgaatccgaggggatgcgccgcgtc
gccgagattgccgaagaagtcaaccctgggacgcttgtctaccctattcgagtggaggag
aatccgtcccgcgacaggtatgcctcgttcgtgggcaacttgaccgaccacgtagccaaa
gtctgcgccgacatcgccgcccacccgatcttgtcgactgccccggcaatcgacgccctc
ggcttctcccagggcggccagttcctgcgcgcctatgtcgagcgctgcaacaaaccaccc
gtccgcagcctgatcacctttggctcacagcacaacggcatcaccgctttccgcgactgc
aagccgaccgactggatttgccgaatcgcgatggcggttcttaaaggcgatgcgtggacc
gacacggtgcagaacaagctcgtgccggcgcagtactatcgcaatcccgacgagtacgaa
aaatacctggagcattccaacttcctcgccgacatcaacaacgagcgcgagatcaagaat
gaagaatacaagaagaacatcgccaagctcgagaactttgtcatgtacatgttcgaggaa
gacacgaccgtcatccccaaggagacggcctggttcgaggatgtcaacggcaccgagagc
acgccgctgcgcgcacgccaactgtatacggaggattggctcggcctgcgcgctctcgac
cgcaagggcgggctcaaattccgcacggcgccgggcgaccacatgcagctgtcggaggag
ctgttgaaggaggcatttggcgacttttatgggccgctgaacctacatcgcggaaggtcg
gacccgcggccggcgaactggcgcagtgatgatctctga

DBGET integrated database retrieval system