KEGG   Myceliophthora thermophila: MYCTH_2310786Help
Entry
MYCTH_2310786     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mtm  Myceliophthora thermophila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYCTH_2310786
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MYCTH_2310786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(2989254..2989263,2989322..2989398,2989470..2989609,2989708..2990005,2990075..2990140)
Genome map
AA seq 196 aa AA seqDB search
MAPTRDPRPLVISGPSGVGKGTLYNLLFQRHPDTFTLSVSHTTRRPRPGEQDGVHYHFVT
KEQFLELKAQNGFLENAQFGDNFYGTSKATIEEQTAKGRTVVLDIEVEGVKQIRASGFPA
RYVFIAPPSEEELERRLRGRGTETEESILKRLKQAKVELEYSKVPGIHDKIIVNDDLERA
YKELEEFVFAEPNASA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggctcctactcgcgatccgcgcccgctcgttatttccggcccctcgggcgtcggcaag
gggaccctctacaatcttctcttccaaagacatcccgacacatttaccctctccgtatcg
cacacgacccgccgcccgcgaccgggtgagcaagatggcgtccactaccacttcgtcacg
aaggagcaatttctggagctgaaggcgcagaacgggtttctcgagaacgcgcagtttggc
gacaacttctacggcacctccaaggccacgatcgaggagcagacggccaaggggaggacg
gtcgtcctggacatcgaggtggagggcgtcaagcagatccgggcttcgggcttcccggcc
cgctacgttttcatcgccccaccgtccgaggaggagttggagaggcggctgcgcggccga
ggaacggagacggaggagtccatcctgaagcggctgaagcaggccaaggtggagctggag
tactccaaggttcccggcatccatgacaagatcattgtgaacgatgatctggagagggcg
tacaaggagctcgaggagttcgtctttgcggaacctaacgcaagtgcataa

DBGET integrated database retrieval system