KEGG   Myceliophthora thermophila: MYCTH_2310867Help
Entry
MYCTH_2310867     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MYCTH_2310867
Peptidases [BR:mtm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MYCTH_2310867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(3145169..3146817,3146878..3146893))
Genome map
AA seq 554 aa AA seqDB search
MATVNVVIKHQGKKYDVEVDTSSTGEVLKYQLYSLTGVEPDRQKILVKGGQLKDDADMSK
LGLKPGQVIMMMGTPGEGGPQVVRPTEKIKFLEDMTEAEAAQQAGATPAGLVNLGNTCYL
NATLQALRSIPELQEALAKHQHTSMSEVPQLDLTYQLKELFKEMSETQGGMTPFTFLNAL
RMAFPQFAERSKKGPGFAQQDAEEAWSQIVSQLRQKLKWPSPTEGEIAGATSFVDKYMSG
EFSSTLECDDPAAREGGEQPTSAKETFLKLNCHIDGQTAHLRDGLLGGLTEKIEKRSEVL
GRDVMYTKRSKISRLPKYLTVHFVRFFWKRDVQKKAKIMRKVTFPHELDAVEFCTDELKK
ALIPVRDKVREVRKEEEDVERARKRRKRNPTLDNGQGEEKKESAKKDGKKSAPSADGDVE
MTETFKTDAEWEAEKDAALLEAKKELNALIDPELRKDEGANKSGIYELRAVVTHQGASAD
SGHYTAYVKKTGPKDPVTGKVGKEDGNWWWFNDDRVTEVTPDKIDALAGGGESHSALILL
YKAIPLPTAEGILE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtcaatgtggtgattaagcaccaaggaaagaagtacgacgtcgaggtcgac
acttcttcgaccggcgaagtcctcaaataccaactctacagcctgaccggtgtcgagccc
gatcgccagaagattctcgtgaagggtggccagctcaaggatgacgccgacatgagcaag
ctggggctgaaacccggccaggttatcatgatgatgggtacgcctggagaggggggtccc
caggttgttcggccgaccgagaagatcaagttcctcgaggatatgactgaagccgaagcc
gcacagcaagcgggcgccactccggccggcttggtaaacctgggcaacacttgttatctc
aatgccacgcttcaggcgctgcgctcgatccccgaactccaggaagcccttgcgaagcac
cagcatacatccatgtcggaggtccctcagctggatcttacgtaccagctgaaggaactc
ttcaaggaaatgtcggagacgcagggcggcatgacgccattcaccttcctgaacgccctt
cggatggccttccctcagtttgccgagcgatcgaagaagggcccggggtttgcgcagcag
gatgccgaagaagcgtggtcgcagattgtgtcgcagttgaggcaaaagctaaagtggccg
agtcccaccgagggcgaaattgctggcgcgacttccttcgttgacaagtacatgtcgggc
gagttctcgagcacgctcgagtgtgacgacccggcggctcgcgaaggtggcgagcaaccg
acctcggccaaggagacgtttctcaagctcaactgccacatcgacggccagactgcccat
ctgagggacggtttactcggcggcttgacggagaagatcgagaagaggtccgaggtcctg
ggcagggacgtgatgtacactaagaggtccaagatctcacggttgcccaagtacctcaca
gtccacttcgtgcgcttcttctggaaacgcgacgtccagaagaaggccaagatcatgcgc
aaggtcacgtttccgcacgagctggacgcggtcgagttttgcacggatgagttgaagaag
gctctcattccggtcagggacaaggtgcgcgaggtgcgcaaggaggaggaggatgtcgag
cgggctcggaaacgccggaagaggaacccgacgcttgacaacgggcagggcgaggaaaag
aaggaaagcgctaagaaggacggcaagaagtctgccccctctgcggacggcgatgtcgag
atgacggagacgttcaagacggatgccgagtgggaagcggagaaggacgcggcgctcctg
gaggccaagaaggagctgaacgccttgatcgacccggagctccggaaagacgaaggtgcc
aacaagtcgggcatctacgaactccgcgcggtggtgactcaccaaggtgccagcgccgac
agcggccattacacggcctacgtgaagaagacgggccccaaggacccggtgaccgggaag
gtcggcaaggaggacggcaactggtggtggttcaacgacgacagggtcaccgaagtgact
ccggacaagatcgatgcgttggctggtggcggtgagtcacactcggcgctcatccttctg
tacaaggctattcctctgcctacggcggaaggcattctggagtaa

DBGET integrated database retrieval system