KEGG   Myceliophthora thermophila: MYCTH_2310881Help
Entry
MYCTH_2310881     CDS       T02231                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mtm  Myceliophthora thermophila
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    MYCTH_2310881
Enzymes [BR:mtm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     MYCTH_2310881
Glycosyltransferases [BR:mtm01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   MYCTH_2310881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(3162042..3162301,3162369..3162658,3162720..3163003,3163059..3164525,3164750..3165212,3165286..3165440)
Genome map
AA seq 972 aa AA seqDB search
MARSASSKPPAARASPPPAPSSIDEKLNSNATKRKDDDYSSEGVEDHDVFLLPGSDFKLV
LAITLLAAAVRLFRIYQPSSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKLMITLFGWLA
GFKGNFDFKDIGKDYVEPGVPYVAMRMFPAICGILLAPTMFLTLKAAGCRTFTAVMGAGL
IIFENGLLTQARLILLDSPLMIATAFTVLSFTSFTNQQELGPSRAFGLSWWFWLVMTGLG
LGMTVSIKWVGLFTIAWVGSLTLVQLWVLLGDYKHVTIRIFAKHFMARVFCLIIIPLTFY
LAMFGIHFLCLRNPGDGDGFMSSEFQSTLNSKAMKNVPADVLLGSRITIRHVNTQGGYLH
SHPLMYPTGSKQQQITLYPHKDDNNLWLVENQTQPLDINGQPINGTDAWYKLPEPHYVEN
GAIIRLNHLATHRRLHSHDVRPPITEADWQNEVSAYGYEGFDGDANDFFRVEIVKKKSKP
GVAQERLRTIDTKFRLIHIMTGCVLFSHKVKLPEWASEQQEVTCARGGTLPNSLWYIEYN
DHPMLGPDAETVNYRNPGFFGKFWELQKVMWKTNAGLVESHAWDSRPPSWPILRRGINFW
GKDHRQIYLIGNPVIWWSATAAVVVYVVFKGIAVLRWQRSCNDYSKPVFKRFDYEVGSSV
LGWALHYFPFFLMQRQLFLHHYFPALYFGIIAFCQIYDFVTARIPGIGLRENPVIGKAGA
VGFLILSMIAFTLLSPLAYGNPWTRAECRRVKLFSTWDWDCNTFLDSYDAYKTLSSTSAA
ASQTPQQPIDAKKVPPAQPPVAGGQQAQVPIVDAQQQQEQQQQAQEEKAKVSGAPVAGNK
RLVHTEERVEYRDQDGNLLNEEQVKALKGKVEFKTRYETRTRIIDAQGNEVLLPPGQQVP
LDQEQKPDAPAGVAPPHPDVEGANSETAKGGIPDEPIPEPKESVEGEREREEKAAKPASE
KQEASAKVDDEV
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatcggcgagctccaagccgccggccgcgagggcatcccccccgccggcgccg
tcgagcatcgatgagaaactcaactcgaacgcgacgaagcgcaaggacgatgattactcc
tccgagggcgtcgaggaccatgatgtctttctgctcccgggctccgacttcaagctcgtc
ctcgccataaccctgctagctgctgctgtgcgcttgttccgcatctaccaacccagcagc
gtcgtgttcgacgaggtccactttggcgggtttgcgaccaagtacatcaagggcaagttc
ttcatggacgtgcacccgccgctcgcaaagttgatgatcacgctcttcggctggcttgcc
ggattcaagggtaacttcgacttcaaggatattggaaaggattatgtcgagcccggcgtc
ccatacgtggccatgcgcatgttcccggccatctgcggcatcctcctggccccgaccatg
ttcctgaccctcaaggctgctggttgccgtactttcaccgctgtcatgggtgccggtctc
atcatcttcgagaatggcctcctcacccaggcgcgtctgattcttctcgactctcctctt
atgatcgccaccgccttcactgttctctcgttcacgtctttcactaaccagcaggagctg
ggtccctcgcgggccttcgggttgagctggtggttttggcttgtcatgaccggcctcggc
ctgggtatgaccgtcagcatcaagtgggttgggctgtttaccattgcctgggtcggctcc
ttgactctggtccagctctgggttctccttggcgattacaagcacgttacaatccgtatc
ttcgccaagcacttcatggcccgcgtcttctgtctcatcatcattcccttaactttctac
ttggccatgttcggaatccacttcctctgcctgcgcaatcccggcgatggcgacggcttc
atgagttccgaattccagtcgactctgaactccaaggcaatgaagaacgtcccggcggac
gttcttctgggtagccgaatcaccatcagacatgtcaacacccagggcggttatctccac
tcccaccctctgatgtaccctaccggttcgaagcaacagcagatcaccctgtacccccac
aaggacgataacaacctgtggctcgtcgagaatcagacccaaccgcttgacatcaacggc
cagcccatcaacggcaccgacgcctggtataagctccccgagcctcactacgtcgagaac
ggcgccatcatccgcctgaaccatctcgccacccaccgtcgtctccactctcacgatgtc
cgccctcccatcacggaggccgactggcagaacgaagtttctgcgtacggttacgagggt
ttcgacggcgatgccaacgacttcttccgcgttgagatcgtcaagaagaagtccaagccc
ggcgtcgcccaagaacgcctccgcacgatcgacaccaagttcaggctcatccacatcatg
accggctgcgtgctgttctcccacaaggtgaaactccccgagtgggcgtcggagcagcag
gaagtcacctgtgcccgcggagggacccttcccaacagcctgtggtacattgagtacaac
gatcatcccatgctgggcccggacgctgagacggtcaactaccgcaatcccggcttcttt
ggtaagttctgggagctgcagaaggtcatgtggaagacgaatgctggtctcgttgaatcc
cacgcctgggactcccgtcctccgtcgtggcccatcctccgccgcggcatcaacttctgg
ggcaaggaccaccgccagatctatctcatcggcaaccctgtcatctggtggagcgctact
gcggccgtcgtcgtctacgtcgtgttcaagggtatcgccgtcctccgttggcagcgcagc
tgcaacgactactcgaagcccgtcttcaagcggttcgattacgaagtcggctcctccgtg
ctcgggtgggctctgcactacttcccattcttcctcatgcagcgccagctcttcctccac
cactacttccccgcgctctacttcggcatcatcgccttctgccagatctatgatttcgtc
acggcacgcattcctggaatcggcttgagggagaatcctgtgattggcaaggctggcgcc
gtcggtttccttatcctgtcaatgattgctttcaccctcctctctccccttgcatatgga
aacccctggacaagggccgaatgcaggcgcgtcaagctgttcagcacctgggactgggat
tgcaacactttcttggacagctacgacgcatacaagacgttgtcctccacctcggctgcc
gcctctcagacacctcagcaaccgatcgatgcgaagaaggtgccgccggctcagcctccc
gtagcgggcggccaacaagcccaggtccccattgtggacgcccagcagcagcaggagcag
cagcagcaagcgcaggaggaaaaggctaaagtttccggcgccccagtggctggcaataag
cgactcgtccatactgaagagcgcgtcgagtaccgcgaccaggacggtaatctcttgaat
gaggagcaggtcaaggccctcaagggcaaggtcgagttcaagacgcgttatgagacgcgg
acccggattatcgatgcccagggcaacgaggtcttgctgcctcccggccagcaggtaccg
ctggaccaggagcagaagcccgatgctccggcgggcgtcgcgcctccccacccggatgtc
gagggtgcgaatagcgagacggccaaggggggtatccctgatgagccgatccccgagccc
aaggagagtgttgagggcgagagggagcgcgaggagaaggcagccaagcctgccagcgag
aagcaggaggccagtgccaaagtggacgacgaggtctga

DBGET integrated database retrieval system