KEGG   Myceliophthora thermophila: MYCTH_2311044Help
Entry
MYCTH_2311044     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
mtm  Myceliophthora thermophila
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCTH_2311044
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     MYCTH_2311044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(3654047..3654676,3654763..3655050,3655107..3655417,3655485..3655602))
Genome map
AA seq 448 aa AA seqDB search
MNGPLYKQANGNVVLVRRVKRKNESPMKQLTRWFVDNQIGFSFNLLALLFLAHGMPRARD
YTAKYFNLSYYNPSTGNYGLGWADGHVVLFCVVLLTGLRAATMEYILAPFAKAQGISKRK
DITRFSEQAWMSIYYAVFWPLGLYIYCQSPAYLNLHELWTGWPDRELTGLMKGYMLAQLG
FWLQQMVVINIEERRKDHWQMFTHHIVTSVLIYTSYRYGHTRVGNLILVLMDVSDLALGI
AKCLKYLGYHTLCDIMFGIFMVSWLIARHFLYLTVCYSVWAHTPNIMPTGCFKGARGNLT
GPFEPPAEKGIAYLLEPLWDSEGMFCYNETVKWSFLSMLLFLQCLTIMWFSMILRVAVKV
IKGAPAEDVRSDDEAGDGEDDGEDEDEYVYEEARPLEEEVGVEEIDLKNWERRTGVKRQA
PITTGVSLPGHSDRKELLGRIGCEKQVE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggccgctctacaaacaggcgaacggcaacgtcgtcctggtgcggagagtgaag
aggaaaaacgagagcccgatgaagcagctcacccgctggtttgtcgacaaccagattggc
ttctcgttcaacctgctcgccctccttttcctcgcccacggcatgcctcgcgcacgagac
tacacggctaaatacttcaacctgtcctactataacccaagcaccgggaactacggcctg
ggctgggccgatggccacgtcgtgcttttctgcgtcgttctgctgaccggtctccgcgcc
gcgaccatggagtatatacttgcgccgttcgccaaggcccagggcatatccaagaggaag
gacatcaccaggtttagcgagcaggcgtggatgtccatctactacgccgttttttggccg
ctgggactgtacatttattgccagtcccccgcctacctcaacctgcacgagctgtggacc
gggtggccggaccgcgagctgaccgggctcatgaagggctacatgctcgcgcagttgggc
ttctggctgcagcagatggtcgtcatcaacatcgaggagcgcaggaaagaccactggcaa
atgttcacccaccacatcgtcacgagcgtgctcatctatacctcgtaccggtacggccac
acccgggtgggcaacctcatcctcgtgctcatggacgtgtccgacttggccctggggatt
gccaagtgcctcaaatacctcggctaccacaccctctgcgacatcatgttcggcatcttc
atggtctcgtggctgattgcccgccacttcctgtacctgaccgtgtgctactcggtctgg
gcgcacacgcccaacatcatgccgacgggctgctttaagggcgcccgcggcaacctcacg
ggcccgttcgagccgcccgcggagaagggcatcgcctacctcctggagccgctgtgggac
tcggagggcatgttctgctacaacgagacggtcaagtggtcgttcctctcgatgctcttg
ttcctgcagtgcctgaccatcatgtggttctccatgatcctccgcgttgccgtcaaggtg
atcaagggcgcgcccgccgaggacgtgcgcagcgacgacgaggccggcgacggcgaggac
gacggcgaggacgaggacgagtatgtgtacgaggaggcgcggccgctcgaggaggaggtc
ggcgtcgaggagatcgacctcaagaactgggagcgcaggacgggtgtgaagcggcaggcc
ccgatcactactggtgtcagcctgccggggcacagcgatcgcaaggagctcctggggagg
attgggtgtgagaagcaggtggagtga

DBGET integrated database retrieval system