KEGG   Myceliophthora thermophila: MYCTH_2311557Help
Entry
MYCTH_2311557     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCTH_2311557
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCTH_2311557
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MYCTH_2311557
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MYCTH_2311557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:join(937054..937143,937251..937829,937919..938899)
Genome map
AA seq 549 aa AA seqDB search
MSNGVAANGASDETHTASQRYLSTRGNDSGLSFEEVVLKGLASDGGLYIPEEVPIASQWE
SWKDLSFVDLAFNVLSLYISPSELPAEDLKDIIRRSYSTFRSDDVTPLIHLQGNIHLLEL
FHGPTFAFKDVALQFLGNLFEYFLVRRNEGKTGRDRYHLTVVGATSGDTGSAAIYGLRGK
KDVSVFMLHPKGRVSPIQELQMTTVLDANVHNLAVTGNFDNCQDIVKALFADPDINSTHK
LGAVNSINWARILAQTVYYFYSYFSLARQQPDSFKVGDKVRFSVPSGNFGDILAGYFAYR
MGLPVDKLVIATNENDILDRFWKTGRYEKKPAYGSAAKGGIESDGVQAHEDGVKETLSPA
MDILVSSNFERLLWYLAYEFAASAGMDDEWNKKQAGQEVSAWLSSLKTKGGFGPVYKDVL
ESARRTFESERVSDPETLDTIRSVYREVGYVLDPHTAVGVEAARRSAARLNGANTPIISL
STAHPAKFAGAVTLALKDEPGFEFDSKVLPPEFVGLDKKEKRVREVANDWKAVRDLVKEE
VEEELKGQR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggcgtcgccgcgaacggcgcctctgacgagacgcacaccgcgtcgcaacgc
tacctcagcacgcggggcaatgatagcggtctctccttcgaggaagtcgtgctcaagggt
ctcgcctccgatggcggtctgtacatccccgaggaagttcccatcgcgtcgcaatgggag
tcctggaaggacctttcctttgtcgaccttgccttcaacgtcctgtcgctctacatctct
ccctccgaactccctgccgaggacctcaaggacatcatccgccgcagttattcgaccttt
cgctccgacgacgttaccccactgatccatctccaaggcaacatacatttgctggaactc
ttccacgggccaacctttgccttcaaggacgtggctctgcagttcctcggcaacctgttc
gaatacttcctggtgcgccggaacgagggaaagacgggccgcgacaggtatcacctcacc
gttgtgggcgccacgagcggtgacacgggttccgccgccatctatggcttgcgggggaag
aaggacgtctcggttttcatgctccaccccaagggccgcgtgagcccgatccaggagctc
cagatgaccactgtcttggacgccaacgtccacaacctggccgttaccggcaactttgac
aactgtcaggacattgtcaaagcgctctttgccgaccccgacatcaactcgacccacaag
ctcggcgccgttaactcgatcaactgggcccgcatcctcgcccagaccgtctactacttc
tactcgtacttctccctcgcccgccaacaaccggattccttcaaggtcggcgacaaggtc
cgtttctcggtcccctcgggcaactttggcgacatcctggccggctacttcgcctaccgc
atgggcctgcccgttgacaagctcgtcatcgcgaccaacgagaacgacattctcgaccgg
ttctggaagacgggcaggtacgagaagaagcccgcctatggctcggccgccaagggcggc
atcgagtcggacggcgtccaggcccacgaggacggcgtcaaggagaccctctcgcccgcc
atggacatcctcgtctcctccaactttgagcgcctcctctggtacctcgcctacgagttc
gccgcgagcgccggcatggacgacgagtggaacaagaaacaggccggccaggaggtttcg
gcctggctatcgagcctcaagaccaagggcggcttcgggcccgtctacaaggacgtgctc
gagtcggcccgccgcaccttcgagagcgagcgggtcagcgacccggagaccctcgacacc
atccgcagcgtgtatagggaggttggctacgtgctggacccccacacggccgtcggcgtc
gaggccgctcgccgctccgccgcccgcctcaacggcgccaacacgcccatcatctcgctg
tcgaccgcccacccggccaagtttgccggcgccgtcacgctcgccctcaaggacgagccg
ggcttcgagtttgactccaaggtgctgcccccagagtttgtcggcctggacaagaaggag
aagagggttagggaggtagcgaatgactggaaggccgtgcgagaccttgtcaaggaggag
gtcgaggaagagctgaagggtcagaggtga

DBGET integrated database retrieval system