KEGG   Myceliophthora thermophila: MYCTH_2311708Help
Entry
MYCTH_2311708     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MYCTH_2311708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(1181422..1182261,1182475..1182570))
Genome map
AA seq 311 aa AA seqDB search
MATSTTGLIPNWFPPNRENYDFILSIWKWMPVVASLQWVIPWYGMGKTSVDSRLNLPGRV
GWLTMEAPGFLTLLYTMGTLSAQVEGWEGEVEGAGAAVPYENKVLAFLFVLHYAYRALLF
PFLQPSMSPIHPVVWLSAVAFQLTNGLAIGAWLGGYGPTTRAAWAAQLRLGTPQFAAGLA
VFYLGLAANYYHDDELREIRRRAARRAREAARKDGPPRKNKTAGTVVVDKHYEIPQAGLF
KVMLYPHYFCEWVEWFGFWMAAGWGCLPARCFLFNEIAAMLPRAVRGRKWYAEKFGEDKV
RGRWAVIPGVC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccacgtcgaccacaggactcattcccaattggttcccaccgaaccgtgagaactac
gacttcatcctctccatttggaaatggatgcctgtggtcgcttcgctgcaatgggtgata
ccgtggtacgggatgggcaagacgtcggtggactcgcggctcaacctgcctgggcgggtc
gggtggctgacgatggaggcgcccgggttcctgacgctgctgtacacgatgggcacgctg
tcggcgcaggttgaggggtgggagggggaggttgagggggcgggggcggcggtcccgtac
gagaacaaggtgctggcgttcctgttcgtgctgcactacgcctaccgggcgctgctgttc
cccttcctgcagccgtccatgtcgccgatccacccggtcgtctggctgtccgccgtcgcc
ttccagctgaccaacgggctggccatcggcgcgtggctgggcgggtacggcccgacgacg
cgcgccgcctgggccgcgcagctccggctcggcacgccgcagttcgccgccggcctggcc
gtcttctacctcggcctcgccgccaactactaccacgacgacgagctgcgcgagatccgg
cgccgcgccgcgcggagggcgcgcgaggccgcccgtaaggacggtcctccccggaagaac
aaaacggccgggacggtggtggtcgacaagcactacgagatcccgcaggccggcctgttc
aaggtgatgctgtacccgcactacttttgcgagtgggtcgagtggttcggcttctggatg
gcggccggctggggatgcctgcccgcgaggtgcttcctgtttaacgagatcgcggccatg
ctgccccgggccgtcaggggccgcaagtggtacgcggaaaagtttggcgaggacaaggtc
cgggggcgctgggccgtcatccccggggtttgctaa

DBGET integrated database retrieval system