KEGG   Myceliophthora thermophila: MYCTH_2312374Help
Entry
MYCTH_2312374     CDS       T02231                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mtm  Myceliophthora thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCTH_2312374
Enzymes [BR:mtm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYCTH_2312374
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_2312374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(2291972..2291998,2292055..2292685,2292742..2293077,2293159..2293966,2294022..2294121,2294190..2294314,2294392..2294476))
Genome map
AA seq 703 aa AA seqDB search
MDPIAVNSSNTLADSGKLAEDDIPRDGTGVLKLDPWLSPFQDSLKRRYAKAQEWIKRIDE
TEGGLDKFSKGTDLFGLRVKEDGSIVYREWAPNAVRASLIGDFNKWDNKAHPMKKNEFGV
FEITIPPTADGKPAIPHKSKVKITLELPTAEWVDRLPAWIKYVTQDLSVSPAYDARFWNP
PPEERYVFKHARPKKPASLRIYEAHVGISSPELRVTTYKEFTKNMLQRIKGLGYNAIQLM
AIMEHAYYASFGYQVNNFFAASSRYGEPEDLKELVDVAHSLGLVVLLDVVHSHASKNVLD
GLNHFDGTDHQYFHEGGRGRHELWDSRLFNYGHHEVMRFLLSNLRFWMDEYQFDGFRFDG
VTSMLYLHHGIGTGFSGGYHEYFGAAVDEEAVAYLMVANEMLHQLYPEVITVAEDVSGMP
ALCLPLSLGGIGFDYRLAMAIPDMWIKILKELKDEDWNIGNICWTLTNRRHGEKTIAYAE
SHDQALVGDKTLMMHLCDAELYTNMSVLTPLTPVIDRGMALHKMIRLLTHGLGGEGWLNF
EGNEFGHPEWLDFPREGNQNSFWYARRQLNLTEDHLLRYQFLNNFDRSMNLCEAKYGWLH
SPQAYISLKHEGDKVIVFERAGLVFVFNFHPTRSYTDYRIGIEVPGTYRIVLDSDTKEHG
GFCRLDPDTRFFTEPLEWNGRKNCTHVYIPCRTAFILALESTL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggatcccatcgctgttaactcgtccaacaccttggcggacagcggcaagttggccgag
gatgacatcccccgggacggcactggagttttgaagctcgacccttggctgtcgcctttc
caggactcgctcaagagacgctacgccaaggcccaggaatggatcaagcggatcgacgag
acagagggcggattggacaagtttagcaaggggacggatctctttggactgcgggtgaag
gaggacggcagcattgtttacagggagtgggctccgaacgccgtgcgggcgtcccttatt
ggcgacttcaacaaatgggacaacaaggcccatccgatgaagaagaacgagttcggcgtc
tttgaaatcaccatccccccaacagccgatggcaagcctgccatcccccacaaatccaag
gtcaagatcactctcgagctgcccaccgcagaatgggtcgacaggctaccggcctggatc
aagtacgtcacgcaggacctgtccgtctccccggcctacgatgcccgcttctggaacccg
ccgccggaggagcggtacgtgttcaagcacgcccggcccaagaagccggccagcctgcgc
atctacgaggcccacgtgggcatctcgtcgcccgagctgcgcgtcaccacctacaaggag
ttcaccaagaacatgctgcagcgcatcaagggcctgggctacaacgccatccagctcatg
gccatcatggagcacgcctactacgccagcttcggctatcaggtcaacaacttcttcgcc
gccagcagccgctacggcgagcccgaggacctgaaggagctggtcgacgtggcccatagc
ctgggactcgtcgtcctgctggacgtggtccacagccacgcgtccaagaacgtgctcgat
ggactgaaccactttgacggcaccgaccatcagtacttccacgagggcggcaggggaagg
catgagctctgggacagcaggctgttcaactatggccatcacgaggtcatgcgcttcttg
ctgagcaacctgcgcttctggatggacgagtatcagtttgacgggttccggttcgatggc
gtcacgagcatgctctatctgcatcacggcattggaactggcttttccggcggttaccac
gagtattttggtgccgctgttgacgaggaggccgttgcgtaccttatggtcgccaacgag
atgcttcaccagctgtatccggaggtcatcaccgtggccgaggacgtctcgggcatgccg
gcgctctgcctgccgctctcgctcggcggcattgggtttgactacagactggccatggcc
attcctgatatgtggatcaagatcctgaaggagttgaaggacgaggattggaatatcggc
aacatctgctggacgctcactaaccgccgccacggagagaagacgatcgcatatgccgag
agccacgatcaggctctggtcggcgacaagacccttatgatgcacctctgcgacgccgaa
ctctacaccaacatgtctgtgctgacgcccctgacccccgtcatcgaccgcggcatggcc
ctgcacaagatgatccgcctcttaacgcacggcctgggcggcgagggctggctcaacttt
gagggcaacgagttcggccacccggagtggctcgacttcccgcgagagggcaaccaaaac
tcgttctggtatgcccggcgccagctgaacctcaccgaagatcacctgctgcgataccag
ttcctcaacaactttgaccgctccatgaacctctgcgaggccaagtacggctggctgcac
tcgccgcaggcctacatctcgctcaagcacgagggcgacaaagtcattgtctttgagcgg
gccggcctggtctttgtcttcaacttccacccgacccggagctataccgactaccggatc
ggcatcgaggtccccggcacctaccgcatcgttctcgattccgacaccaaggagcacggc
ggcttctgccgcctcgatccggacacccgcttcttcacggaaccgctcgagtggaacggg
aggaaaaactgcactcatgtttacattccgtgcagaaccgcttttattctggcgctcgag
tcaactctctag

DBGET integrated database retrieval system