KEGG   Myceliophthora thermophila: MYCTH_2312538Help
Entry
MYCTH_2312538     CDS       T02231                                 

Definition
glycosyltransferase family 39 protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mtm  Myceliophthora thermophila
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mtm00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:join(2548442..2548719,2548782..2548836,2548892..2549389,2549460..2550219,2550274..2550332,2550389..2550973)
Genome map
AA seq 744 aa AA seqDB search
MTSGNDRAAVVSGADVGDAARRRHVPGTPQQVVVPQQPQAADDKKKAKKEPSFLELLDQW
EWLIAPIIFTALAFFTRLYKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPAGKLLVG
LSGYLAGYNGSFEFKSGDTYPPEVNYVFMRQFNAFWGAVCVPMAYWTAKELKFRRPAVWL
VTLMVLCENSYTTISRFILLDSMLLFGTVATTLCWAKFHNQRKNSFEPEWFFWLFMTGLS
IGFVTSVKLVGLFVTALVGLYTIEDLWNKFGDTKMPVTELAAHFAARVVGLIILPFLVYL
LSFAIHFAVLINSGPGDAQMSSLFQANLRGTNVGRDSPLEVAYGSLVTIKNMGYGGGLLH
SHIQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDPEADPRFIADGEVIRLLHAQT
GRNLHSHQIAAPITKSQWEVSCYGNATIGDTKDHWRIEVVSDAASRDRSRIRTLTTAFRL
KHEVLGCYLRAGNKNLPQWGFKQIEVTCTKENNPRDTYTHWNIESHINEKLPPGDPGQYK
SPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCGWDDKIVKYFLL
GNPMVYWGSTAALGVFALLVAWYVLRWRRGYRELSQAEIDQIHYSGLYPVLGWFLHYLPF
VIMARVTYVHHYYPALYFAILTFGFLSDWFLRNRSKAVQWGVYALLDATVIGLYIYFIPI
CWGMTGPNRQYRYMKWFDTWRMSD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacctccggaaacgacagggccgctgtcgtctccggcgccgacgtcggtgacgcggcc
aggagacgccacgttcccggcacgcctcagcaggtcgtcgttccgcagcagccgcaagca
gcggacgacaagaagaaggcgaagaaagaaccatccttcctcgagctgctcgaccagtgg
gagtggctcattgcacctatcatcttcactgccctcgccttcttcactcgtctctacaag
attggcctttctcccatcgtgacctgggatgaagctcacttcggaaagtttggcagtcac
tatctgaagcgcgagttctactttgacgtccatcccccggccggaaagctcctcgtcggc
ctcagcggatacctcgccggttacaatggatcctttgagtttaagtccggcgatacatac
cctcccgaggtcaactacgttttcatgcgccagttcaacgccttctggggcgccgtctgc
gtgccaatggcctactggaccgccaaggagctcaagttcaggcgccccgccgtctggctc
gttactctgatggttctttgcgagaactcgtacaccaccatcagccgcttcatcctcctc
gactcgatgctcctgttcggcaccgtcgcgaccacgctctgctgggccaagtttcacaat
cagcgcaagaacagcttcgagccagagtggttcttctggctgttcatgactggcctgagc
atcggtttcgtcactagcgtgaagctggtcgggctcttcgtcacggcccttgtcggctta
tacaccatcgaggatctgtggaacaagtttggcgacaccaagatgcctgtgaccgaactg
gccgcccactttgctgctcgcgttgttggcctcatcatcctgccgttccttgtttacctg
ctcagcttcgccatccacttcgccgttcttatcaacagcggacccggcgacgctcagatg
tcctcgctcttccaggccaacctccgcggcactaacgtcggccgtgacagcccgttggag
gttgcgtacggctctctggtgacaatcaagaacatgggctatggcggaggccttctccat
tcccacattcagacgtaccctgagggctccggccagcaacaggtgacctgctaccaccac
aaggatgccaataacaactggttcttctaccccaaccgcggcgacactccctatgacccg
gaggccgatccccgtttcatcgccgatggcgaagtcatccgcctgctccacgcccagacc
ggccgcaacctccactcgcatcagattgccgctcccatcaccaagtctcagtgggaggtt
tcctgctatggcaatgccaccattggtgataccaaggaccactggaggatcgaagtcgtc
agcgatgctgcctcccgcgaccggagcagaattcgcacccttacgacggctttccgcctg
aagcacgaggttctcggctgctatcttcgcgctggtaacaaaaacctgcctcagtgggga
ttcaagcagatcgaggttacctgcaccaaggagaacaacccgcgcgacacctacacccac
tggaacattgagtcgcacatcaacgagaagctgccccccggtgaccctggccagtacaag
tctcccttcttcaaggactttgtccacctgaacgtcgccatgatgacctccaacaatgcc
ctggttcccgaccccgataagcaagacgacctggcgtcgcagtggtggcagtggcccatc
ctgcacgtcggactgcgcatgtgcggctgggacgacaagatcgtcaagtacttcctgctc
ggcaatcccatggtctactggggctcgacggccgcccttggcgtcttcgctctgttggtc
gcctggtacgtcctgcgttggcggcgcggataccgcgagctgtcgcaggcggaaatcgac
cagatccactattccggcctgtatccggtccttggctggttcttgcactacttgccgttc
gtcatcatggcccgcgtcacctacgtccaccactactacccggcgctgtatttcgccatt
ctcaccttcggcttcctgtcagactggttcctccggaaccgcagcaaagccgtgcagtgg
ggggtgtacgcgctcttggacgcgaccgtcatcggcctgtatatttacttcatccccatc
tgctggggcatgacggggccgaacaggcagtacaggtacatgaagtggttcgacacgtgg
cggatgtcggactaa

DBGET integrated database retrieval system