KEGG   Thermothelomyces thermophila: MYCTH_2312538Help
Entry
MYCTH_2312538     CDS       T02231                                 

Definition
(RefSeq) glycosyltransferase family 39 protein
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00514  Other types of O-glycan biosynthesis
mtm00515  Mannose type O-glycan biosynthesis
mtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    MYCTH_2312538
   00514 Other types of O-glycan biosynthesis
    MYCTH_2312538
Enzymes [BR:mtm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     MYCTH_2312538
Glycosyltransferases [BR:mtm01003]
 O-Glycan biosynthesis
  O-linked Man type
   MYCTH_2312538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_4TMC MIR DUF2976
Motif
Other DBs
NCBI-GeneID: 11509504
NCBI-ProteinID: XP_003667109
JGI: 2312538
UniProt: G2QMZ1
Position
7:join(2548442..2548719,2548782..2548836,2548892..2549389,2549460..2550219,2550274..2550332,2550389..2550973)
Genome map
AA seq 744 aa AA seqDB search
MTSGNDRAAVVSGADVGDAARRRHVPGTPQQVVVPQQPQAADDKKKAKKEPSFLELLDQW
EWLIAPIIFTALAFFTRLYKIGLSPIVTWDEAHFGKFGSHYLKREFYFDVHPPAGKLLVG
LSGYLAGYNGSFEFKSGDTYPPEVNYVFMRQFNAFWGAVCVPMAYWTAKELKFRRPAVWL
VTLMVLCENSYTTISRFILLDSMLLFGTVATTLCWAKFHNQRKNSFEPEWFFWLFMTGLS
IGFVTSVKLVGLFVTALVGLYTIEDLWNKFGDTKMPVTELAAHFAARVVGLIILPFLVYL
LSFAIHFAVLINSGPGDAQMSSLFQANLRGTNVGRDSPLEVAYGSLVTIKNMGYGGGLLH
SHIQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDPEADPRFIADGEVIRLLHAQT
GRNLHSHQIAAPITKSQWEVSCYGNATIGDTKDHWRIEVVSDAASRDRSRIRTLTTAFRL
KHEVLGCYLRAGNKNLPQWGFKQIEVTCTKENNPRDTYTHWNIESHINEKLPPGDPGQYK
SPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCGWDDKIVKYFLL
GNPMVYWGSTAALGVFALLVAWYVLRWRRGYRELSQAEIDQIHYSGLYPVLGWFLHYLPF
VIMARVTYVHHYYPALYFAILTFGFLSDWFLRNRSKAVQWGVYALLDATVIGLYIYFIPI
CWGMTGPNRQYRYMKWFDTWRMSD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacctccggaaacgacagggccgctgtcgtctccggcgccgacgtcggtgacgcggcc
aggagacgccacgttcccggcacgcctcagcaggtcgtcgttccgcagcagccgcaagca
gcggacgacaagaagaaggcgaagaaagaaccatccttcctcgagctgctcgaccagtgg
gagtggctcattgcacctatcatcttcactgccctcgccttcttcactcgtctctacaag
attggcctttctcccatcgtgacctgggatgaagctcacttcggaaagtttggcagtcac
tatctgaagcgcgagttctactttgacgtccatcccccggccggaaagctcctcgtcggc
ctcagcggatacctcgccggttacaatggatcctttgagtttaagtccggcgatacatac
cctcccgaggtcaactacgttttcatgcgccagttcaacgccttctggggcgccgtctgc
gtgccaatggcctactggaccgccaaggagctcaagttcaggcgccccgccgtctggctc
gttactctgatggttctttgcgagaactcgtacaccaccatcagccgcttcatcctcctc
gactcgatgctcctgttcggcaccgtcgcgaccacgctctgctgggccaagtttcacaat
cagcgcaagaacagcttcgagccagagtggttcttctggctgttcatgactggcctgagc
atcggtttcgtcactagcgtgaagctggtcgggctcttcgtcacggcccttgtcggctta
tacaccatcgaggatctgtggaacaagtttggcgacaccaagatgcctgtgaccgaactg
gccgcccactttgctgctcgcgttgttggcctcatcatcctgccgttccttgtttacctg
ctcagcttcgccatccacttcgccgttcttatcaacagcggacccggcgacgctcagatg
tcctcgctcttccaggccaacctccgcggcactaacgtcggccgtgacagcccgttggag
gttgcgtacggctctctggtgacaatcaagaacatgggctatggcggaggccttctccat
tcccacattcagacgtaccctgagggctccggccagcaacaggtgacctgctaccaccac
aaggatgccaataacaactggttcttctaccccaaccgcggcgacactccctatgacccg
gaggccgatccccgtttcatcgccgatggcgaagtcatccgcctgctccacgcccagacc
ggccgcaacctccactcgcatcagattgccgctcccatcaccaagtctcagtgggaggtt
tcctgctatggcaatgccaccattggtgataccaaggaccactggaggatcgaagtcgtc
agcgatgctgcctcccgcgaccggagcagaattcgcacccttacgacggctttccgcctg
aagcacgaggttctcggctgctatcttcgcgctggtaacaaaaacctgcctcagtgggga
ttcaagcagatcgaggttacctgcaccaaggagaacaacccgcgcgacacctacacccac
tggaacattgagtcgcacatcaacgagaagctgccccccggtgaccctggccagtacaag
tctcccttcttcaaggactttgtccacctgaacgtcgccatgatgacctccaacaatgcc
ctggttcccgaccccgataagcaagacgacctggcgtcgcagtggtggcagtggcccatc
ctgcacgtcggactgcgcatgtgcggctgggacgacaagatcgtcaagtacttcctgctc
ggcaatcccatggtctactggggctcgacggccgcccttggcgtcttcgctctgttggtc
gcctggtacgtcctgcgttggcggcgcggataccgcgagctgtcgcaggcggaaatcgac
cagatccactattccggcctgtatccggtccttggctggttcttgcactacttgccgttc
gtcatcatggcccgcgtcacctacgtccaccactactacccggcgctgtatttcgccatt
ctcaccttcggcttcctgtcagactggttcctccggaaccgcagcaaagccgtgcagtgg
ggggtgtacgcgctcttggacgcgaccgtcatcggcctgtatatttacttcatccccatc
tgctggggcatgacggggccgaacaggcagtacaggtacatgaagtggttcgacacgtgg
cggatgtcggactaa

DBGET integrated database retrieval system