KEGG   Myceliophthora thermophila: MYCTH_2313137Help
Entry
MYCTH_2313137     CDS       T02231                                 

Definition
glycoside hydrolase family 27 protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mtm  Myceliophthora thermophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCTH_2313137
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCTH_2313137
   00600 Sphingolipid metabolism
    MYCTH_2313137
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    MYCTH_2313137
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MYCTH_2313137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(3850782..3851379,3851496..3851702,3851792..3852035,3852165..3852258,3852365..3852472))
Genome map
AA seq 416 aa AA seqDB search
MKYARNSFLVALYWPRVAKALDNGVGLTPHMGWSSWNVAQCDAASAKYALDTAEKFISLG
LKDLGYEYINIDDCWSLKSRDENGKLVPDPGKWPDGIKPVADRIHDLGLKFGLYGCAGQK
TCAGYPGSDGDKYAASDVSQLVEWGVDFWKYDNCYTPCLDNPPPQTCQRPAGNSQEWYAP
MRDAILGVQETRKIHFNLCNWGRDDVWGWGDDYGHSWRMSVDNWGDWESVERIGSAAADI
AEYSGPGGFNDLDMLYLGSPKLNANEERLHFGLWAIAKSPLVLGLDLATISNATLDIIRN
KGIIDINQDRLGKAATTFTPPGRPGPESESGRIYPYWAGPLSDGVVIGLCAGSSAGTYAV
DFRDVPGLGDGSYSWEEMYTGQTGTGTGVSFDIDLHDMRVIKVKTAGTKGGRAAEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgcgcgcaacagtttcctcgtggccctgtattggccgcgagtcgccaaggcc
ttggataatggggtcggcttgacgcctcacatgggatggagcagctggaatgtcgcccag
tgcgatgctgcctcggccaagtatgccctcgacacggccgagaagtttatttcgctcggg
ctcaaggacctcgggtacgaatacatcaacattgacgactgctggtcgctcaagtctcgc
gacgagaacgggaagcttgtgcccgatccgggcaaatggcccgacggcatcaaacccgtc
gccgatcggatccacgacctggggctcaagtttggtctgtacggctgtgccggccagaag
acctgcgccggttaccccgggagcgacggggataagtacgcggcctcggatgtctctcag
ctggtcgagtggggagtcgatttttggaagtatgacaactgctacaccccctgcttggac
aacccaccgccgcaaacctgccagagaccggcgggaaacagccaagagtggtacgccccg
atgcgggatgccatcctgggcgtccaggagacgcgcaagatccacttcaacctctgcaac
tggggacgtgacgacgtctgggggtggggcgatgactacggacactcgtggcggatgagc
gtcgacaactggggagactgggagagcgtcgagcggatcggcagcgcggcggccgacatt
gccgagtacagcgggccgggcgggttcaacgacctcgacatgctgtacctcgggtcgccg
aagcttaacgccaacgaggagcgcctccacttcggcctctgggccatcgccaagtcgccc
ctcgtgctggggctcgacctcgccaccatctcgaacgcgacgctcgacatcattcgcaac
aagggcatcatcgacatcaaccaggacaggctgggcaaggccgctaccaccttcaccccg
cccggccggcccggcccggagagcgagagcggcaggatctacccgtactgggccggcccg
ctcagcgacggcgtcgtcatcggcctctgcgccggctcctcggcggggacctacgccgtc
gacttcagggacgtcccgggcctcggggacggcagctactcgtgggaggagatgtacacg
ggccagaccggcaccggcaccggcgtctcgttcgacattgacctccacgacatgcgggtc
atcaaggtgaagacggcgggcacgaaaggaggacgggcggcagaactttga

DBGET integrated database retrieval system