KEGG   Thermothelomyces thermophila: MYCTH_2313212Help
Entry
MYCTH_2313212     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
mtm  Thermothelomyces thermophila
Pathway
mtm00260  Glycine, serine and threonine metabolism
mtm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtm01100  Metabolic pathways
mtm01110  Biosynthesis of secondary metabolites
mtm01130  Biosynthesis of antibiotics
mtm01230  Biosynthesis of amino acids
Module
mtm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCTH_2313212
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCTH_2313212
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYCTH_2313212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PALP PcrB
Motif
Other DBs
NCBI-GeneID: 11510106
NCBI-ProteinID: XP_003667399
JGI: 2313212
UniProt: G2QNX8
Position
7:join(4063578..4063625,4063718..4063876,4063953..4064185,4064259..4065957)
Genome map
AA seq 712 aa AA seqDB search
MEAIKQTFQRCKAQNRAALVTYVTAGYPTAESTPNVLLSMQKGGADIIELGVPFTDPIAD
GPTIQTANTIALQNGVTIESTLQMVRDARKLGVRAPILLMGYYNPLLSYGEERLMKDCIE
AGINGFIVVDLPPEEAISFRKWCSKGGLSYVPLIAPATSDARMRILCQLADSFIYVVSRQ
GVTGALGTINAHLPELLSRVKKYSGDKPAAVGFGVSTREHFVSIAQLADGVVVGSMIVTT
LQKAAKGEEYKAVQDFCSYLCGRTSSAEDEATREVGIIEAVSGARDSNGEVGVDGVVKDT
DDLVAQLAAMHNKIPERFGEFGGQYVPESLMDCLSELEQGFNKIKDDPSFWEEYRSYYPW
MGRPGHLHKAERLTEYAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTKIIAETG
AGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVN
EALRAWVVNLEDTHYIIGSAIGPHPFPTIVRTFQSVIGNETKAQMLEKRGKLPDAVVACV
GGGSNAVGMFYPFSNEPSVKLLGVEAGGDGIDTSRHSATLSAGTKGVLHGVRTYILQNEH
GQISDTHSVSAGLDYPGVGPELSNWKDTERAKFIAATDAQAFIGFRLMSQLEGIIPALES
SHGIYGAIELAKTMNKDQDVVICLSGRGDKDVQSVADELPKLGPKIGWDLRF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaggccattaagcagacgttccagcgttgcaaggcccagaacagggctgcgctcgtc
acttatgtcaccgccggctaccctacggccgagtcgacccccaatgtcctcctctccatg
cagaagggtggcgccgacatcatagagctcggtgtgcccttcaccgatcccattgctgat
ggcccgaccatccagaccgccaacaccattgccctccaaaatggcgttacaattgagtcg
actctgcagatggtccgagacgctcgcaagctcggcgtgcgcgctcccattctgcttatg
ggctactacaaccctctgcttagctacggagaggagcgccttatgaaggactgcatcgag
gctggcattaatgggttcatcgtcgtcgaccttcctcctgaggaggccatctccttccgc
aagtggtgcagcaagggaggactctcctatgtgcctctcatcgccccggctacttctgac
gcgcgcatgcgcattctatgccagctggccgactcgttcatctacgtcgtctcccgccaa
ggtgtcacgggcgctctgggcacgattaatgctcaccttcccgaactactgtctagggtc
aagaagtatagtggcgacaagcccgcagctgttgggtttggtgtgagcacccgcgagcac
ttcgtctctatcgctcagcttgcggacggtgtggtggtcggcagcatgatcgtcaccacc
ctgcagaaggccgccaaaggcgaggaatacaaggcagttcaggacttttgctcctacctc
tgtggtcgtacctcctcggccgaggatgaggccactcgggaagtcggcatcatcgaggct
gtctccggtgccagagactccaacggcgaagtcggtgtggacggcgttgtcaaggacact
gatgaccttgtcgcacagctggcggctatgcacaacaagattcccgagcgttttggcgag
tttggtggccagtatgttcccgagtcgctgatggactgcctgtccgagctcgagcaaggc
ttcaacaagatcaaggatgatccctccttctgggaggaataccgcagctactacccttgg
atgggccgccctggccacttgcacaaggcagagaggttgaccgagtacgccggcggcgcc
aacatctggctcaagcgcgaggatctcaaccataccggctcccacaaaatcaacaacgcc
cttggccagctcctgcttgcccgccgccttggcaagaccaagatcattgccgagacggga
gccggccagcacggtgtcgccacagctaccgtgtgcgccaagttcggcatggagtgcact
gtctatatgggtgctgaggacgtccgccgtcaggctctgaacgtcttccgcatgaagctc
cttggcgccaaggttgttgccgtcgaggccggcagccgtaccctgcgggatgcggtcaac
gaagccctccgcgcctgggttgttaacctagaggacacacactacatcattgggtccgcc
atcggtcctcatcccttccctaccattgtccggactttccagtctgtcatcggtaacgaa
accaaggcccagatgcttgagaagcgtggcaagcttccggatgctgttgtggcgtgcgtg
ggcggcggtagtaacgcggtcggcatgttctacccattcagcaacgagccaagcgtcaag
cttctcggcgtcgaggccggcggtgatggcatcgacacatcccgtcacagtgctactctc
tctgccggcaccaagggcgtccttcacggggtccggacctatatcctgcagaatgaacac
ggtcagatcagcgacacccactccgtctcggccggcctggactaccccggcgtggggccg
gagctgtccaactggaaggacacggaacgcgccaagtttatcgctgccacagatgcccag
gcctttatcggttttcgcctaatgagccagctggagggcatcatccccgccttggagtcg
tcgcatggtatctatggcgccattgagttggcaaagaccatgaacaaagatcaagacgtg
gtcatttgcctgagcggccgcggcgacaaggatgtgcagagcgttgctgatgaattgccc
aagctgggccccaagatcggctgggacttacggttctga

DBGET integrated database retrieval system