KEGG   Myceliophthora thermophila: MYCTH_2313212Help
Entry
MYCTH_2313212     CDS       T02231                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYCTH_2313212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCTH_2313212
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCTH_2313212
Enzymes [BR:mtm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYCTH_2313212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:join(4063578..4063625,4063718..4063876,4063953..4064185,4064259..4065957)
Genome map
AA seq 712 aa AA seqDB search
MEAIKQTFQRCKAQNRAALVTYVTAGYPTAESTPNVLLSMQKGGADIIELGVPFTDPIAD
GPTIQTANTIALQNGVTIESTLQMVRDARKLGVRAPILLMGYYNPLLSYGEERLMKDCIE
AGINGFIVVDLPPEEAISFRKWCSKGGLSYVPLIAPATSDARMRILCQLADSFIYVVSRQ
GVTGALGTINAHLPELLSRVKKYSGDKPAAVGFGVSTREHFVSIAQLADGVVVGSMIVTT
LQKAAKGEEYKAVQDFCSYLCGRTSSAEDEATREVGIIEAVSGARDSNGEVGVDGVVKDT
DDLVAQLAAMHNKIPERFGEFGGQYVPESLMDCLSELEQGFNKIKDDPSFWEEYRSYYPW
MGRPGHLHKAERLTEYAGGANIWLKREDLNHTGSHKINNALGQLLLARRLGKTKIIAETG
AGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMKLLGAKVVAVEAGSRTLRDAVN
EALRAWVVNLEDTHYIIGSAIGPHPFPTIVRTFQSVIGNETKAQMLEKRGKLPDAVVACV
GGGSNAVGMFYPFSNEPSVKLLGVEAGGDGIDTSRHSATLSAGTKGVLHGVRTYILQNEH
GQISDTHSVSAGLDYPGVGPELSNWKDTERAKFIAATDAQAFIGFRLMSQLEGIIPALES
SHGIYGAIELAKTMNKDQDVVICLSGRGDKDVQSVADELPKLGPKIGWDLRF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaggccattaagcagacgttccagcgttgcaaggcccagaacagggctgcgctcgtc
acttatgtcaccgccggctaccctacggccgagtcgacccccaatgtcctcctctccatg
cagaagggtggcgccgacatcatagagctcggtgtgcccttcaccgatcccattgctgat
ggcccgaccatccagaccgccaacaccattgccctccaaaatggcgttacaattgagtcg
actctgcagatggtccgagacgctcgcaagctcggcgtgcgcgctcccattctgcttatg
ggctactacaaccctctgcttagctacggagaggagcgccttatgaaggactgcatcgag
gctggcattaatgggttcatcgtcgtcgaccttcctcctgaggaggccatctccttccgc
aagtggtgcagcaagggaggactctcctatgtgcctctcatcgccccggctacttctgac
gcgcgcatgcgcattctatgccagctggccgactcgttcatctacgtcgtctcccgccaa
ggtgtcacgggcgctctgggcacgattaatgctcaccttcccgaactactgtctagggtc
aagaagtatagtggcgacaagcccgcagctgttgggtttggtgtgagcacccgcgagcac
ttcgtctctatcgctcagcttgcggacggtgtggtggtcggcagcatgatcgtcaccacc
ctgcagaaggccgccaaaggcgaggaatacaaggcagttcaggacttttgctcctacctc
tgtggtcgtacctcctcggccgaggatgaggccactcgggaagtcggcatcatcgaggct
gtctccggtgccagagactccaacggcgaagtcggtgtggacggcgttgtcaaggacact
gatgaccttgtcgcacagctggcggctatgcacaacaagattcccgagcgttttggcgag
tttggtggccagtatgttcccgagtcgctgatggactgcctgtccgagctcgagcaaggc
ttcaacaagatcaaggatgatccctccttctgggaggaataccgcagctactacccttgg
atgggccgccctggccacttgcacaaggcagagaggttgaccgagtacgccggcggcgcc
aacatctggctcaagcgcgaggatctcaaccataccggctcccacaaaatcaacaacgcc
cttggccagctcctgcttgcccgccgccttggcaagaccaagatcattgccgagacggga
gccggccagcacggtgtcgccacagctaccgtgtgcgccaagttcggcatggagtgcact
gtctatatgggtgctgaggacgtccgccgtcaggctctgaacgtcttccgcatgaagctc
cttggcgccaaggttgttgccgtcgaggccggcagccgtaccctgcgggatgcggtcaac
gaagccctccgcgcctgggttgttaacctagaggacacacactacatcattgggtccgcc
atcggtcctcatcccttccctaccattgtccggactttccagtctgtcatcggtaacgaa
accaaggcccagatgcttgagaagcgtggcaagcttccggatgctgttgtggcgtgcgtg
ggcggcggtagtaacgcggtcggcatgttctacccattcagcaacgagccaagcgtcaag
cttctcggcgtcgaggccggcggtgatggcatcgacacatcccgtcacagtgctactctc
tctgccggcaccaagggcgtccttcacggggtccggacctatatcctgcagaatgaacac
ggtcagatcagcgacacccactccgtctcggccggcctggactaccccggcgtggggccg
gagctgtccaactggaaggacacggaacgcgccaagtttatcgctgccacagatgcccag
gcctttatcggttttcgcctaatgagccagctggagggcatcatccccgccttggagtcg
tcgcatggtatctatggcgccattgagttggcaaagaccatgaacaaagatcaagacgtg
gtcatttgcctgagcggccgcggcgacaaggatgtgcagagcgttgctgatgaattgccc
aagctgggccccaagatcggctgggacttacggttctga

DBGET integrated database retrieval system