KEGG   Myceliophthora thermophila: MYCTH_2313336Help
Entry
MYCTH_2313336     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mtm03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1314264..1314452,1314515..1314586,1314655..1315143)
Genome map
AA seq 249 aa AA seqDB search
MAEQVDLTTIPISPDGENKPDGASNENAEEKLVTVFHDKDNFNVKHPLSSRWTLWFTKPA
SGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQNKH
GGKWSYQFKDKRSVNIDELWLHTMLAAIGETLEDEDDGEVMGVVVNVRKAFYRIGVWTRT
MGRHIPGRGDGDIAGGKGRSAEKGKEILMAIGRRFKNVLKLPPNEVVEFSGHTDSAHSGS
TRAKAKIVV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcaagtcgacctcactacgattcccatttcgcccgatggcgaaaacaagccc
gatggcgcctccaacgagaatgccgaggagaaacttgtcaccgtgttccacgacaaggac
aacttcaacgtcaagcaccctctgtcgagtcggtggacgctctggttcacaaagcccgct
agcggaaagggtgacaactggaatgatttgctaaaggaagtcatcacctttgagtcggtg
gaggaattttggggtgtatataacaacattgcccccgtctcggaacttgccctcaaatcg
gattatcacctcttcaaggaaggcgtgcggccagagtgggaggacccgcaaaacaagcac
ggcggcaagtggtcgtaccagttcaaggataagcggtcggtcaatatcgacgagctgtgg
ctgcacacgatgctcgccgccatcggcgagacgctggaagacgaggatgacggcgaggtg
atgggcgtggttgtcaacgtgcgcaaggcgttctaccgtatcggcgtgtggacccgcacg
atgggccgccacattcccggtcgcggggacggcgacatcgccggcggcaagggccgatcg
gcggagaagggcaaggagatcctgatggctattggccgtcggttcaagaacgttctcaag
ctgccgcccaacgaggtggtcgagttctcgggccacaccgacagcgcgcacagcggcagc
acacgcgccaaggcgaagatcgtggtctaa

DBGET integrated database retrieval system