KEGG   Myceliophthora thermophila: MYCTH_2314176Help
Entry
MYCTH_2314176     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mtm  Myceliophthora thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(8780160..8781770,8781829..8782107,8782170..8782187)
Genome map
AA seq 635 aa AA seqDB search
MEESGKNCIIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEDYDFDNLDAIPSDKVV
MFVLATYGEGEPTDNAVDFTEFITAENPSFSLDNDPPLGNLNYVAFGLGNNTYEHYNAMV
RNINKALQRLGAHRIGEAGEGDDGAGTMEEDFLAWKEPMWKALAEKMGLEEREAVYEPIF
GITEREGLTRDSLEVYLGEPNKMHLDGTPKGPFNAHNPYIAPIEKSYELFNVKDRNCLHM
EIDISGSNLSYQTGDHIAVWPTNAGEEVDRFLDIFGLAEKRHNVISVKALEPTAKVPFPT
PTTYDAIARYHMEICAPVSRQFLSTLAAFAPDDESKAEMTKLGNDKDYFHSKVNAHYLNI
ARLLAIVSKGKKWTNVPFSALIEGITKLQPRYYSISSSSLEQPKKISITAVVESQELPGR
GDPFRGVATNYLLALKEKQNGDPNPNPFGLTYEITGPRNRYDGIHVPVHVRHSNFKLPSD
PTKPIIMVGPGTGVAPFRGFVRERRKMVENGQDVGKTILFFGCRRSTEDFMYEKEWEEAK
QVLGDKFEIVTAFSREGPKKVYVQHRLKERAKEVNELLQQKAYFYVCGDAANMAREVNAA
LAQILSAERGIPEAKGEEIVKQMRQANQYQEDVWS
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtccggcaaaaactgcatcatcttctacggatcgcaaaccggcaccgctgag
gattatgcgtcgagactcgccaaggagggcaagagccgtttcggcctcgagaccatggtc
gccgatctggaggactacgacttcgataacctcgatgccatccccagtgacaaggttgtc
atgttcgtgctggcaacatacggcgagggcgagccgaccgacaatgccgtcgacttcacc
gagtttatcaccgccgaaaacccgtccttctccctcgacaacgaccctcctcttggcaac
ctgaactacgtcgctttcggtctcggcaacaacacgtacgaacactacaatgcaatggtt
cgcaacatcaacaaggcactgcagagactaggtgctcatcgcattggagaagcgggcgaa
ggcgacgacggcgccggcactatggaggaggacttcttggcttggaaggagccgatgtgg
aaggctctcgctgaaaagatgggcctggaagagcgcgaggccgtttacgagcctattttc
ggcatcactgagagggagggcctcactcgcgattcgcttgaagtctatctcggagaaccc
aacaagatgcacctcgacggcactcccaagggccccttcaacgcacacaacccttacatt
gcccccatcgagaaatcttatgagctgttcaacgtcaaggatcgcaactgcctccacatg
gaaatcgacattagcggctccaacctcagctaccagactggtgatcatattgcggtttgg
cccaccaacgccggcgaagaggtcgaccgcttcttggatatcttcggtcttgccgagaag
cgccacaacgtcatcagcgtcaaggccctcgaaccgaccgccaaggtgcctttcccaacc
ccgaccacgtacgacgccatcgcccgctaccacatggaaatctgcgccccggtttctcgc
cagtttctctccactctcgctgcattcgctccggacgacgagtccaaggctgagatgacc
aagctcggtaacgacaaggactacttccactccaaggtcaatgctcactatctcaacatc
gctcgcctcctggcaatcgtgagcaagggtaagaagtggaccaacgttccgttttccgcc
ctcattgagggcatcacgaaactgcagcctcgttactattccatctcgtcgtcctccctg
gaacaacccaagaagatctccataacggcggtcgtcgagtcgcaggagcttccgggccgt
ggggacccgttcaggggtgttgcgaccaactatctcttggccctcaaagagaagcagaac
ggagacccgaacccgaatcctttcggtttgacctacgaaattaccgggccgcgcaacagg
tacgacggcattcacgtcccggtccacgttcgccactccaacttcaagctcccttcggat
cctaccaagccgatcatcatggtcggacccggtaccggtgttgcgcccttcaggggtttc
gtccgcgaaagaagaaagatggtcgagaatggtcaggatgtcggaaagaccatcctcttc
ttcggctgccggagatcaaccgaggactttatgtatgagaaggaatgggaggaggccaag
caggttctcggtgacaagttcgaaattgtcaccgctttctctcgcgaggggcccaagaaa
gtttatgtccagcatcggttgaaggagcgcgccaaggaggtcaacgagctattgcagcag
aaggcttacttctacgtctgtggcgacgctgccaacatggctcgcgaggtcaacgctgcc
ctggcgcagattctgtccgcagagcgcggcatcccagaagccaagggcgaggagatcgtg
aaacagatgaggcaagcgaaccagtatcaggaggatgtgtggtcgtag

DBGET integrated database retrieval system