KEGG   Myceliophthora thermophila: MYCTH_2314567Help
Entry
MYCTH_2314567     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCTH_2314567
Messenger RNA biogenesis [BR:mtm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     MYCTH_2314567
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MYCTH_2314567
Translation factors [BR:mtm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MYCTH_2314567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(1871911..1872169,1872228..1873058,1873125..1873153))
Genome map
AA seq 372 aa AA seqDB search
MDNLWSRRANSSKLSLSTGSGQDSPSGRNSSFKRFGGDSSSLGKHTFGSVTTPGGSLASP
IGGASSAFGLGSGAFASFGSAKTPKTPKSPGNPFDAALGAAAKTPTAEKSAKDGASGGKS
ISKPAFATSLKEAGKTATPSAGPSTHQLRNCWVFWFRPPISKANGFIEYEKTLHPIAAVD
CVEHFFKIYQHLKRPSTLPLVSDYHLFKKGICPIWEDEENKNGGKWVVRLRKGVADRYWE
DLLLAVIGDQFGEASEEVCGVVLSVRNGEDILSIWARANGQRVLKIRETMRRILSFPPDT
KLEWKSHDSSIQQRTAIEESRREKANQHHHGDKRSSNKQHQQQHSQQQQQQQQQQQQQQQ
QADDQKNPTNSS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggataatctatggagtcgccgtgccaactcgagcaagctctccctctcaacaggttct
ggtcaagacagtccgtcgggacgcaactcttccttcaagcgatttggcggtgatagctcg
tcgcttggaaaacacacattcggttcggtaacgacaccaggcggcagcttggcgtctccg
attggcggggcttcaagcgcctttggcctgggctcgggcgccttcgcctcgttcggctcg
gccaagacgcccaagacgcccaagtcgccggggaacccgttcgacgcggccctgggcgcc
gccgcgaagaccccgactgctgagaaatctgcaaaggacggggcctcgggcggcaagtcg
attagcaagccggcgtttgctacttccctgaaggaggcgggaaagacggcgaccccgtcg
gcgggaccgtctacccaccagctgcgcaactgctgggtgttttggttccgtccgcccatc
tccaaggcgaacgggttcatcgagtacgaaaagacgctacatccgatcgccgcggtcgac
tgcgtcgaacacttcttcaagatctaccagcacctgaagcggccatcgacgctccccttg
gtgtcggactatcatctcttcaagaagggcatctgtccaatatgggaggatgaagagaac
aagaacggggggaagtgggtggtgcgtctgagaaaaggcgtcgccgaccggtactgggag
gacctgttgctggccgtcattggcgatcagttcggcgaggctagtgaggaggtgtgcggg
gtcgtcctcagcgtccggaacggtgaggacatcctgagcatctgggcccgcgcgaacggg
cagcgggtcctcaagattcgtgagaccatgcggcgaatcttgtctttccccccggatacc
aagctcgagtggaagagccacgactcgagcattcagcagcgcacggccatcgaggagtcg
cggcgagaaaaggcgaaccaacaccatcatggcgacaagcggtcgtcgaacaaacagcat
caacagcaacattcgcagcagcaacagcagcagcagcagcagcagcagcagcagcagcag
caggcggatgaccagaagaaccccaccaattcttcataa

DBGET integrated database retrieval system