KEGG   Myceliophthora thermophila: MYCTH_2314890Help
Entry
MYCTH_2314890     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MYCTH_2314890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(4824595..4824858,4824931..4825382,4825480..4825837)
Genome map
AA seq 357 aa AA seqDB search
MAGLFGTQSSTTSNTLGDLKQDVELGSPPEDSITDLAFNPNPTDPKDFLAVSSWDKKVRV
YEIMSNGQGQGKAQMEHDGPVFAVDFFKDGQKVISAGADKQAKVLDLATGQSVQVAQHDQ
PVRCVRYFEANGTPMAVTGSWDKTIKYWDFRSAQPAGTVTCQERVYTMDVRDNLLVIGTA
DRYIDVINLKEPAKFYKTLQSPLKWQTRVVSCFTDSQGFAIGSIEGRCAIQYVEDKDSNL
NFSFKCHRDQPQGNVTNVYAVNDISFHPQHGTFSTAGSDGTFHFWDKDAKHRLKGYPSVG
GSITATTFNKTGNIFAYAISYDWSKGYQGNTSNYPTKVMLHPVLPDECKPRPSVKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccttttcggcacgcagtcgtcgacgacgagcaacacgctcggcgacctcaag
caggacgtcgagctcgggagcccgcccgaggacagcatcaccgacctcgctttcaacccc
aacccgaccgacccgaaggatttcttggcagtctcgagctgggataagaaagtgcgcgtc
tacgagatcatgagcaatggccagggccaagggaaggcgcagatggagcacgatggcccc
gtctttgcggtcgacttcttcaaggacggccaaaaggtcatctcggccggcgccgacaag
caggccaaggtgctggacctcgctaccggccagtcggtgcaggtggcgcagcacgaccag
cccgtgcgttgcgtgcggtactttgaggccaacggcacgccaatggccgtgacgggctcg
tgggacaagacgatcaagtactgggacttccggagcgcgcagcccgccgggaccgttacc
tgccaggagcgggtctacacgatggacgtccgagacaatctcctggtaatcgggacggcg
gaccgctatatcgacgtgatcaacctgaaggagccggccaagttctacaagacgctccag
agcccgctcaagtggcagacgcgggtcgtcagctgcttcaccgactcgcagggcttcgcc
atcgggagcatcgagggccggtgcgccatccagtacgtcgaagacaaggactccaacctc
aacttctccttcaaatgccaccgcgaccagccccagggcaacgtgaccaacgtgtacgcg
gtaaacgacatctcgttccacccccagcacggcaccttcagcacggccggtagcgacggc
accttccacttctgggacaaggacgcaaagcaccgcctcaaggggtacccgtcggtcggc
ggcagcatcacggcgacgacgtttaacaagacgggcaacatctttgcctacgccatcagc
tacgactggtccaaaggatatcagggcaacaccagcaactacccgaccaaggtgatgctg
caccccgtgctgccggatgagtgcaagccccggccgagcgtcaagaagaggtga

DBGET integrated database retrieval system