KEGG   Myceliophthora thermophila: MYCTH_2315024Help
Entry
MYCTH_2315024     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mtm  Myceliophthora thermophila
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MYCTH_2315024
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MYCTH_2315024
Enzymes [BR:mtm01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     MYCTH_2315024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(830829..830965,831071..831720,831857..831984)
Genome map
AA seq 304 aa AA seqDB search
MPNLASARYGKDNVRVCKVQRDEKTGFHTVTEMTVSCLLEGQIETSYTAADNSVVVATDS
IKNTIYIKAKEHPVNPPELYASLLGQHFLDKYPHISTAHVNLAVHRWTRLEVDGAPHPHS
FYRDGQETRNVEVAVSRGPGGIRIKSSIVGLSVFKSTGSAFHGFVRDEYTTLPETWDRIL
STDVDCSWTWKPFDTVEAVQQRVERFDKAWESARGIILRLFAVEESPSVQNTMYKMSEQI
LEAVPEVDRVDFALPNKHYFELDLSWHKGIKNTGKDAEVYVPQSGPNGLIKCEVARDETT
LAHR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacctcgcgtccgcccgctacggcaaggataatgtccgcgtctgcaaggtccag
agggacgagaagacgggttttcatacggtcacagagatgacggtgtcctgtttgctcgag
ggccagatcgagacatcgtacaccgccgcggacaacagcgtcgtggtcgccacggactcg
atcaagaacacaatctacatcaaggccaaggaacaccccgtcaacccgccagagctctac
gccagcctcctgggccagcacttcctcgacaagtacccgcacatcagcacagcgcacgtc
aacctcgcggtgcaccggtggacgcgcttggaggttgacggcgcgccgcacccgcacagc
ttctaccgcgacggccaggagacgcgcaacgtcgaggtcgccgtctcccgcgggccgggc
ggcatccgcatcaagagcagcatcgtcggcctgtcggtgttcaagagcaccggctcggcc
ttccacgggttcgtgcgcgacgagtacaccaccctgcccgagacctgggaccgcatcctg
tcgaccgacgtcgactgctcctggacctggaagcccttcgacaccgtcgaggccgtgcag
cagcgggtggagcggttcgacaaggcgtgggagagcgcccgcggcatcatcctgaggctg
tttgccgtcgaggagagcccgtcggtgcagaatactatgtacaagatgtccgaacagatc
ctcgaggcggtgcctgaagttgacagggttgactttgcgctgccgaacaagcactacttc
gagctcgatctgagctggcacaagggaatcaagaacacggggaaggacgccgaggtttat
gtgccacagtctgggcccaacggtttgatcaagtgcgaggttgcccgtgacgaaacgact
ctggcgcaccggtga

DBGET integrated database retrieval system