KEGG   Myceliophthora thermophila: MYCTH_2315100Help
Entry
MYCTH_2315100     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mtm  Myceliophthora thermophila
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    MYCTH_2315100
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MYCTH_2315100
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MYCTH_2315100
Protein phosphatases and associated proteins [BR:mtm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     MYCTH_2315100
Transcription machinery [BR:mtm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     MYCTH_2315100
Spliceosome [BR:mtm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    MYCTH_2315100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1516137..1516155,1516256..1516284,1516358..1516657,1516723..1517124,1517220..1517399))
Genome map
AA seq 309 aa AA seqDB search
MADQHDVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKFGRGR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagcacgacgtcgacctcgactcgataatcgaccgcctcctggaggtgcgg
ggcagccgcccgggcaagcaagtccagctgctcgaggcagagatccgttatctctgcacc
aaggcccgcgagattttcatttcccagcccattctgctcgagctcgaagctcctatcaag
atctgcggtgacatccatgggcaatactacgacttgctccgtctcttcgagtatggcggt
ttccctcccgaagccaactatctcttcctgggtgactacgtggatcgcggcaagcagtct
ctggagaccatctgcttgcttctggcctacaagatcaagtacccagagaactttttcatc
ctgcgcggcaaccacgagtgcgcgtccatcaaccgcatctacggcttctacgacgagtgc
aagcgtcggtacaacatcaagctgtggaagaccttcacggactgcttcaactgcctgccc
attgctgccatcattgacgagaagatcttcaccatgcacggtggcctgagccccgacctc
aactcgatggaacagattcgccgcgtcatgaggccgactgatatccccgactgcggcttg
ctctgcgaccttctatggtccgacccagacaaggatatcaccggctggtccgaaaacgat
cgcggtgtctcgttcacgttcggtccagatgtcgtctcccgcttccttcaaaaacacgac
atggacctcatctgccgcgcccatcaggtcgtcgaggatggttacgagttcttctccaag
cgccagcttgttaccctgttcagcgcccccaactattgcggcgagtttgacaacgccggt
gcgatgatgagcgtggatgaaagcttgctctgctctttccagatcctcaagcccgcagag
aagaaacaaaagttcgggcgcggtcgataa

DBGET integrated database retrieval system