KEGG   Myceliophthora thermophila: MYCTH_2315100Help
Entry
MYCTH_2315100     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mtm  Myceliophthora thermophila
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:mtm03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mtm04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1516137..1516155,1516256..1516284,1516358..1516657,1516723..1517124,1517220..1517399))
Genome map
AA seq 309 aa AA seqDB search
MADQHDVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKFGRGR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagcacgacgtcgacctcgactcgataatcgaccgcctcctggaggtgcgg
ggcagccgcccgggcaagcaagtccagctgctcgaggcagagatccgttatctctgcacc
aaggcccgcgagattttcatttcccagcccattctgctcgagctcgaagctcctatcaag
atctgcggtgacatccatgggcaatactacgacttgctccgtctcttcgagtatggcggt
ttccctcccgaagccaactatctcttcctgggtgactacgtggatcgcggcaagcagtct
ctggagaccatctgcttgcttctggcctacaagatcaagtacccagagaactttttcatc
ctgcgcggcaaccacgagtgcgcgtccatcaaccgcatctacggcttctacgacgagtgc
aagcgtcggtacaacatcaagctgtggaagaccttcacggactgcttcaactgcctgccc
attgctgccatcattgacgagaagatcttcaccatgcacggtggcctgagccccgacctc
aactcgatggaacagattcgccgcgtcatgaggccgactgatatccccgactgcggcttg
ctctgcgaccttctatggtccgacccagacaaggatatcaccggctggtccgaaaacgat
cgcggtgtctcgttcacgttcggtccagatgtcgtctcccgcttccttcaaaaacacgac
atggacctcatctgccgcgcccatcaggtcgtcgaggatggttacgagttcttctccaag
cgccagcttgttaccctgttcagcgcccccaactattgcggcgagtttgacaacgccggt
gcgatgatgagcgtggatgaaagcttgctctgctctttccagatcctcaagcccgcagag
aagaaacaaaagttcgggcgcggtcgataa

DBGET integrated database retrieval system