KEGG   Myceliophthora thermophila: MYCTH_2316564Help
Entry
MYCTH_2316564     CDS       T02231                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
mtm  Myceliophthora thermophila
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MYCTH_2316564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(1816749..1816773,1816845..1816939,1817002..1817192,1817595..1817610))
Genome map
AA seq 108 aa AA seqDB search
MGFSAGDAKKGANLFKTRCEQCHTVDANGGNKIGPALHGLFGRKTGSVEGYAYTDANKQK
GITWNEETLFAYLENPKKYIPGTKMAFGGLKKEKDRNDLITYLKEATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctctgctggtgacgccaagaagggtgccaacctcttcaagacgcgctgcgag
cagtgccacaccgttgacgccaacggcggcaacaagatcggccccgcgctccacggcctg
ttcggtcgcaagaccggctccgtcgagggctacgcctacaccgacgccaacaagcagaag
ggcatcacctggaacgaggagactctgttcgcctacctcgagaaccccaagaagtacatc
cccggcaccaagatggccttcggtggtctgaagaaggagaaggacaggaacgacctcatc
acctacctcaaggaggccactgcctaa

DBGET integrated database retrieval system