KEGG   Myceliophthora thermophila: MYCTH_29375Help
Entry
MYCTH_29375       CDS       T02231                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MYCTH_29375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(<1323087..>1326563)
Genome map
AA seq 1159 aa AA seqDB search
VDRPSSNNDGKEGDGGDLAQSLDRLTISTSPPAKTPRSPRSVRPAGPAPLKTATDRSPSF
PSPGNAVRSPLRCSSSASVLHPSQSATPTLLRKASLNSLHSANTVTPSRRASSGSILPSS
RVRSGRSPLRSVSPELPEIVIPTPHSIATDHFKAELDIHHGPEPTRRAETVVILQDACYG
HRYSRPRASRAQLSTIVERPERIKACVLGLSAAYVRLGERHQDGAFPLHPDTDAASLPSI
PFRIQKSTRRLSLGSQTVTNVHGTKWMEELKMMCETAEAKLVGGGKELQRPDIDRGANAE
APQKFHEGDLYLCSESLEAIEGALGGVCDAVDAVFQPQGPRRAFVAIRPPGHHCSASHPS
GFCWVNNVHVGIMHGVLSHGLTHAAIIDFDLHHGDGSQAIAWQHNARGVGLAKNAAWWKK
TSIGYFSLHDINSYPCEMGDEEKVRNASVCIDGAHGQSIWNVHLQGWKTEADFWALYESK
YAVLLEKTRAYLRSHTERLKASGLNSRAAIFLSAGFDASEYEDPGMQRHNVNVPTEFYAR
FTRDVVRLAAEEGTSVEGRIISVLEGGYSDRALCSGVFSHLCGLAGDGPSNKDQELGSGA
SETGQQFTQQRARKDSSASERGVRRYESSWWSTAQLEQLEATLAAPVPAPRVIRNTPPPT
YSSPTQASQAKAVNPKNRSGSVLSPTTSNGASRVSFQLPPPPEVPWAIATVQLSRLLIPS
GRQTASCTVEELNADATRIRRERQAALAGSAPPTASSAPEDRPPTRMGLRERKPKPPPVD
DDVDRKTRRKTVAGPAVLDTEAGSRGATSVPGKQSRPSRRLSAASTAVSSESSEVPPSVP
RIVPIRSSSKQEVVNNAEASSDVAGPGGSSNLQVKKTRAPTKKEAVPRAPKGKKSTGPAN
GAPAQTTPSANVTAASSADKAGDAVDKLAGEMKKIKITVVTKAQKEARERERLAREKLSQ
AKTVPGPPPAAGDGSPSQSTPGAADTTTTTTTTTNSNNNNSYLTSETEHQLPSPTPSPAP
QAPQIQTPVNPSTPPAEEDRNIATTPSVASPPPTDPRHVPLPASSPPPALTETPLKNDAT
PPHTSEDSFVHYQPEGPTPGPPPQSAAEQPQQQNQQLQWLPPNVSATPVPSPIKKKDLPV
FSSTGFIPFAPRPGTHSDG
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgaccaagcagcaacaatgatgggaaggagggcgacggaggagacctcgcgcag
tctttggaccgcctaaccatctcaacatctcctcccgccaaaacaccccgctctccccgt
tccgtccgtcccgccggacctgcccccctcaagacggccactgaccgctcgcccagtttt
ccgtccccgggcaatgcggtgcgcagtccccttcgctgttcctcctctgcttcggtactt
cacccttctcagtctgccactccaactctgctgcgcaaggcctcgttgaactcgctccat
tccgcaaacaccgtcactccgtctcgtcgcgcgagttccgggagcatcttgccgtctagc
agggttagatcgggcagatcgcccctccgaagcgtgtcccctgagctgccagagatcgtc
atcccgaccccccattccatcgccaccgaccacttcaaggccgagttggacatacatcat
ggcccagagcctacccgccgagccgagaccgtcgtgatccttcaagacgcctgctatggc
catcggtactcccgcccgcgggcgtcgcgggcccaactcagcaccatcgtcgagcgaccc
gagaggattaaggcctgtgtcctgggcttgtcggcagcgtacgtgcgactgggcgaacgg
catcaggatggcgcattccccctccacccggacacggacgctgcctcgcttccctcaata
cccttccggatccagaaatccacccggcgcctgtccctgggatcgcagacggtgaccaac
gtgcatgggacaaagtggatggaggaattgaagatgatgtgcgagacagccgaggcgaaa
ctggtcgggggcggtaaagagcttcagcggccagacatcgaccgaggcgcgaacgcagaa
gcgccgcagaagttccacgagggcgatctgtacctctgctcggagtcgctagaggctatt
gaaggggcgctcggcggcgtgtgtgacgccgtcgacgccgtctttcaacctcaggggccg
cgccgggcgttcgtcgccattcggccacccgggcatcactgctcggcttcccacccttcg
ggcttttgttgggtcaacaatgtccacgtcggcatcatgcacggcgtgctcagccatggc
ttgacgcacgccgccatcatcgacttcgacctgcaccacggggacggctcccaggcgatt
gcctggcagcataacgcccgaggcgtcggcttggctaagaacgcggcctggtggaagaag
acgtcgatcggctatttcagcctccacgacatcaactcttatccgtgcgagatgggcgac
gaagaaaaggttaggaacgcaagtgtctgcatcgacggcgcgcacggccagagcatctgg
aacgtacacctgcaaggctggaagaccgaggccgacttctgggccctgtacgagtccaag
tatgcggttctcctagaaaagacgcgcgcttacctaaggagccacaccgagcgcctcaag
gcgtcgggcctgaattcaagagctgccatcttcctgtcggccggcttcgacgcgagcgag
tatgaggaccccggcatgcagcgacacaacgtcaacgtgccgacagagttctacgcccgc
ttcacccgtgacgtcgtccgtcttgcggccgaagaggggacgagcgtagaaggccgcatc
atcagcgtcctggaaggaggctacagtgatcgcgcgctctgttctggtgtcttcagccac
ctctgcggtctcgccggagatgggcctagcaacaaggaccaggagcttggtagcggggct
tcggagaccggccagcagttcacccagcagcgcgctcggaaagactctagtgccagtgag
cggggcgttcggcggtacgagtcgtcgtggtggtctactgcgcaactcgagcagcttgag
gctacccttgctgcgcctgtgccggcaccccgagtcatccgcaacactccgccacctacc
tactcatcacctactcaggcgtctcaagcgaaagctgtcaaccccaagaatcggagcggt
tctgtgttgtccccaaccacgagtaacggagcgtctcgggtctcgttccagctgccgccg
ccgccggaggttccttgggccatcgccacggtgcagctgagcagactactgattccaagc
gggcgtcaaacggccagctgcactgttgaagagctcaatgccgacgctaccaggattagg
cgtgagcgccaggcggccctggccggatccgctcctccgacggcctcttctgccccagaa
gaccggccgcccactagaatgggactacgggaacgaaagccgaaacccccgcctgttgac
gacgacgtagatcgtaagaccaggcgaaagaccgtggccgggccggcggttcttgacaca
gaggctggatcacgcggagccacttcggttcctggcaagcagtctcggccgtcacggcgt
cttagcgcggcgtcgaccgctgtctcttccgagagctcagaagtgccaccgtcggttcct
cgaatcgtcccgattcgcagcagctcgaagcaggaagtggtgaacaatgccgaagcctca
tcggatgttgccgggcccggcggcagcagcaacctccaggttaagaagactagagccccg
accaagaaggaggcagtgcctcgtgcacccaaggggaagaagtccactggccccgcaaac
ggagcgccggcacagactaccccttctgcgaatgtcactgctgcatcatcggccgacaaa
gccggcgacgcggtggacaagctggccggcgagatgaagaagatcaagatcacggtggtc
accaaggcacagaaggaagctcgtgagcgggaacgcctggcgagagaaaagctttcacag
gccaagaccgttcccgggcccccgccggccgcgggagatggatctccttcgcaatctaca
cccggtgctgctgacaccaccaccaccaccaccaccaccaccaacagcaacaacaataac
tcctacctaacctcggaaaccgaacatcagctgccctcaccaaccccgtctccggcgcca
caggcaccccagatccaaacccccgtcaacccctcaacgccgcccgcagaagaagacagg
aacattgcaacaaccccgtcagtcgcttccccgccaccaacagacccgcgtcacgtaccc
ctcccagcaagctcaccgccaccagcgctcacggagacgcccctcaaaaacgatgccact
cccccgcacaccagcgaagattcctttgtccactaccaacccgagggtccaaccccggga
ccgcctccccagtccgcggcagagcagccgcaacaacaaaaccagcagctacagtggctg
ccgccgaacgtgtccgctacgcctgtgccgtcgcccatcaagaagaaggacctgccggtg
tttagtagcaccggtttcatcccttttgccccgaggcccggtacgcacagcgacggg

DBGET integrated database retrieval system