KEGG   Myceliophthora thermophila: MYCTH_39035Help
Entry
MYCTH_39035       CDS       T02231                                 

Definition
carbohydrate esterase family 8 protein (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mtm00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(1662836..1663846)
Genome map
AA seq 336 aa AA seqDB search
MLSKVLGFVSLAAAAAAAPLQSRAARTSPPEGCLTVGSSGTYKTVQSAVDALSRSATSEQ
CIFIYGGTYQEQVTIPALRSALVVYGETEDTSRFSANKVTITQSRSQDDSADNDATATLR
AHTANLRVYNVNLVNTRGKGSQALALSAQADRQGYYACQFRGYQDTVLANEGAQVYARSY
VEGATDFIFGQRARAWFDAADIRVLAASKGYITANGRDSADNPSYYVIHNSAVSARSGDS
VPAGAYYLGRPWRNYARVVFQKTSLSGVVNAAGWSVWNTGDERTDEVEFGEYGNTGAGAG
ASGSRAAFAKQLSAPVSIETVLGSDYASWVDTSYLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaaggtactcgggttcgtctcgctcgccgcggcggcggcggcggcgcctctc
cagagccgggccgcgcgcacctcgccgcccgagggttgcctgacggtgggcagctcgggg
acgtacaagacggtccagtcggcggtggatgcgctgagcaggtcggcgacgtcggagcag
tgcatcttcatctacgggggcacgtaccaggagcaggtcaccatcccggcgctgcggtcg
gcgctggtggtgtacggcgagaccgaggacacgagcaggttctcggccaacaaggtgacc
atcacgcagtcgcggagccaggacgattcggccgacaacgacgcgacggcgacgctgcgg
gcgcacacggccaacctgcgcgtctacaacgtcaacctggtcaacacgcgcggcaagggg
tcgcaggcgctggcactgagcgcacaggcggaccggcagggctactacgcctgccagttc
cgcggctaccaggacacggtgctggccaacgagggggcgcaggtgtacgcgcgcagctac
gtcgagggcgccaccgacttcatcttcggccagcgcgcccgcgcctggttcgacgccgcc
gacatccgcgtcctggccgcctccaagggctacatcaccgccaacggccgcgactcggcc
gacaacccgtcctactacgtcatccacaactcggccgtctcggcccgcagcggcgactcc
gtccccgccggcgcctactacctcggccggccgtggcgcaactacgcccgcgtcgtcttc
cagaagaccagcctgtccggggtcgtcaacgccgccggctggagcgtctggaacacggga
gacgagcggacggacgaggtcgagtttggcgagtacggaaacacgggcgccggcgccggc
gcgtccgggtcccgtgccgccttcgccaagcagctgtccgcccccgtgagcatcgagacc
gtgctgggcagcgactacgcaagctgggtcgacacgtcgtacctgtcgtag

DBGET integrated database retrieval system