KEGG   Myceliophthora thermophila: MYCTH_39101Help
Entry
MYCTH_39101       CDS       T02231                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mtm  Myceliophthora thermophila
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:mtm03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(<9605272..9605367,9605446..9606159)
Genome map
AA seq 269 aa AA seqDB search
DEEESSSGSAPNSPVIGAARRRFDDEEAQDNDVLDSWDAAEDSEVEREKAKKAAEAKAKA
EAEAAAKKKSKAQRIAERQAERAAAKANAEKDESEEETEAQRRERLRRTEKESDLRHAED
LFGNIGISSGRKATTAGSAVPIDANDPTKTVDLSALPLFNPATKVQFEELRNILGPILAA
SAKKPHYTLFLQEFTKQLAKDLPSDQIKKIASTLTALSNEKMKEEKAAEKGGKKTKAAKT
KTSLAGVTRGGGMAAEMDVYDDVDDGFGE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gatgaagaggagtcgtcctccggctccgccccgaactcaccagttattggagccgctcgc
cgaaggttcgatgatgaggaggcccaagacaacgacgtgctagattcttgggacgccgcc
gaagattccgaggtggagcgcgaaaaggcaaagaaggccgcggaagccaaagcgaaggcg
gaagcagaagccgctgctaagaagaagagcaaggcgcagcggatagctgaacggcaggcc
gagcgcgccgcggccaaggccaacgcggagaaggacgagagcgaggaggagacggaagct
cagaggcgcgagcgcctccgtcgcaccgaaaaggagtcggatctgcgtcacgccgaggat
ctcttcggcaacatcggcatcagcagcgggcgcaaggcgacaaccgccggaagcgccgtg
cccatcgacgcaaacgacccgaccaagacagtcgacctgtcagcgcttcctctcttcaac
cccgcgacgaaggtgcagttcgaggagctgcgcaatatcttgggccccattctggcggcc
agcgccaagaagccacactacacgctcttcttgcaggagttcaccaagcagcttgccaag
gacctgccgagcgaccagatcaagaagattgcgagcaccctgacggcactgagtaacgag
aagatgaaggaggagaaggcggccgagaagggcggcaagaagacgaaggcggccaagaca
aagacttctcttgccggtgttacccgcggcggtggtatggctgcggagatggatgtgtac
gacgacgtcgatgacggctttggcgagtaa

DBGET integrated database retrieval system