KEGG   Myceliophthora thermophila: MYCTH_40891Help
Entry
MYCTH_40891       CDS       T02231                                 

Definition
carbohydrate esterase family 8 protein (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mtm  Myceliophthora thermophila
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MYCTH_40891
   00500 Starch and sucrose metabolism
    MYCTH_40891
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     MYCTH_40891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(3875056..3875141,3875206..3875261,3875329..3875477,3875555..3875972,3876033..3876319))
Genome map
AA seq 331 aa AA seqDB search
MRLSLCRLASAVLSLTFVGDALPGASAQAASRTTPPSGCLSVGSGRQYSTITEAITALGS
GTSAACIFIYPGTYNVADGVSIKYKGPLTLYGSTSDTSKQSANQVTFTRNKGSADAGSLD
ASATFNIVSSNFRAYNINFRNTYGTQGQAVAVAANGDKQAYYACGFYGYQDTLYAKSGRQ
YYSNCYIEGAVDFIFGAAAAWFGECTVASNGGGYITANSRSTTADTTWYAFDHSTIRAAA
GISLAGKVFLGRPWRVLARVIFQNSELTDVVHPEGWTTMAAGATPEFREFQNTGAGSNTS
QRKWLTFPTTAGVTKTQLWGSDWKTWIDTAW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaggctatccctttgcaggttggcatcggcggtgctatccctgacctttgtgggcgat
gctttgcctggtgcttctgcgcaggccgcgagccggaccactccgccgagcggatgtctg
tcagtaggaagcggcaggcagtacagcaccatcacggaagcgataactgccttgggttct
ggcacttcagctgcctgcattttcatctacccgggaacctacaacgttgctgatggtgtt
tcgatcaagtacaagggcccgctgacactgtatgggtcaacctcggataccagcaagcag
agcgccaaccaggtgacctttaccaggaacaagggttcggccgatgctgggagcctggac
gcgtctgccacgttcaacatcgtgagcagcaacttccgggcgtacaacatcaactttcgt
aacacatacggcacgcagggccaggccgtggccgtggccgccaacggcgacaagcaggcc
tactatgcgtgcggtttctacggctaccaggacacgctgtacgccaagagcggtcgccag
tactactccaactgctacatcgagggcgccgtcgacttcatctttggcgccgcggctgcc
tggtttggcgagtgtaccgttgcctccaacggcggcgggtacatcaccgctaactctcgc
tccactacggctgatactacctggtatgcttttgatcacagtactatccgggcggctgcc
ggaattagcttggccggcaaagtgttcctcggccgaccgtggcgcgtacttgcccgcgtt
atcttccaaaattccgagttgaccgacgtcgtgcaccctgagggctggaccacaatggct
gcaggagctactcccgagttccgggagttccaaaacactggtgcaggatctaacacatcc
cagagaaagtggctcactttcccaacgactgctggtgtcactaagacccagctctggggc
agtgactggaagacttggatagatactgcatggtga

DBGET integrated database retrieval system