KEGG   Myceliophthora thermophila: MYCTH_49824Help
Entry
MYCTH_49824       CDS       T02231                                 

Definition
glycoside hydrolase family 11 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MYCTH_49824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(4545212..4545629,4545839..4546113))
Genome map
AA seq 230 aa AA seqDB search
MVSFKALVLGAVGALSFPFNVTELSEAHARGENVTELLMSRAGTPSQTGWHGGYYFSFWT
DNGGTVNYWNGDNGRYGVQWQNCGNFVGGKGWNPGAARTINFSGSFNPSGNGYLAVYGWT
QNPLIEYYIVESFGTYDPSSQAQVLGTFYQDGSNYKIAKTTRYNQPSIEGTSTFDQFWSV
RENHRTSGSVNVGAHFARWQQAGLRLGTHNYQIMATEGYQSSGSSDITVW
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtctccttcaaggccctcgttctcggcgccgttggcgccctctccttccctttcaac
gtcaccgagctgtccgaggcgcacgcccggggcgagaatgtgaccgagctcttgatgtct
cgcgccggcacgccgagccagaccggctggcacgggggctactacttctccttctggacc
gacaacggcggcaccgtcaactactggaacggcgacaatggcagatacggtgtccagtgg
cagaactgcggcaactttgtcggcggtaagggatggaaccccggcgcggcgcggaccatc
aacttcagcggctccttcaacccgtcgggcaacgggtacctggccgtgtacgggtggacg
cagaacccgctgatcgagtactacatcgtcgagtcgttcggcacgtacgacccgtcgtcg
caggcccaggtcctcggcaccttctaccaggacggcagcaactacaagatcgccaagacg
acccgctacaaccagccctccatcgagggcaccagcaccttcgaccagttctggtccgtc
cgcgagaaccaccgcaccagcggcagcgtcaacgtcggcgcccacttcgcccgctggcag
caggccggcctccgcctcggcacccacaactaccaaatcatggccaccgagggctaccag
agcagcggctcctccgatatcaccgtctggtaa

DBGET integrated database retrieval system