KEGG   Myceliophthora thermophila: MYCTH_52068Help
Entry
MYCTH_52068       CDS       T02231                                 

Definition
glycoside hydrolase family 5 protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mtm  Myceliophthora thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mtm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(188041..188101,188188..188528,188627..188868,188948..189005,189069..189135,189207..189253,189327..189524))
Genome map
AA seq 337 aa AA seqDB search
MKFLDVLLGAAAASSALAAPTCTTKTKRAGKFKFVGVNQSCAEFGQDTLPGQLNKHYTWP
AKSSIDTLLATGMNTIRIPFMMERLIPNQLTGTVNETYSAGLIDTVSYVTSKGAYAVIDP
HNFGRYYTQVITDVEGFKAWWTTTAGLFADNDKVIFDTNNEYHDMDQSLVVNLNQAAIDG
IRAAGATSQYIFIEGNSWTGAWTWVSSGNGESLLNLSDPEGDDKLIYEMHQYLDEDGSGT
HEQCVSGTIGRERLQAATEWLKANGKKAILGETAGGANDQCISALTGMLSFMEENSDVWQ
GWLWWAAGPWWADYMYSIEPPSGTAYTKVLPSLQPYI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcgacgtccttctcggtgccgcagctgccagctcggccctggcagcgccg
acttgcacaaccaagacaaagcgcgcgggcaagttcaagtttgtcggcgtcaaccagtcc
tgcgccgagtttggccaggacacgctcccgggccagctcaacaagcactacacctggccg
gccaagtcgagcattgatacactcctcgccaccggaatgaacaccattcgcatcccgttt
atgatggagcgtcttatccccaaccaactgacgggaaccgtcaacgaaacgtactccgcg
gggcttatcgataccgtttcctacgtcacgagcaagggagcctatgctgtcattgacccc
cataacttcggccggtactacacgcaagtcatcaccgacgtcgaaggcttcaaggcctgg
tggacgaccacggccgggctgtttgccgacaacgacaaggtcatcttcgacaccaacaac
gagtaccacgacatggaccaatcgctcgttgtcaatctgaaccaggccgccatcgacggc
atccgggccgccggcgccacctcgcagtacatctttatcgagggcaactcgtggacgggc
gcatggacctgggtctcctcgggcaacggcgagtccctgctgaacctgtcggacccggag
ggcgacgacaagctcatctacgagatgcaccagtacctggacgaggacgggtcgggcacg
cacgagcagtgcgtctcgggcaccatcggccgggagcgcctccaggcggcgaccgagtgg
ctcaaggccaacggcaagaaggccatcctgggcgagacggccggcggcgccaacgaccag
tgcatctcggccctgaccggcatgctctccttcatggaggagaactcggacgtctggcag
ggctggctctggtgggctgccggtccctggtgggccgactacatgtactcgattgagccg
ccgagcggtaccgcgtacaccaaggttttgcccagcctccagccttatatctga

DBGET integrated database retrieval system