KEGG   Myceliophthora thermophila: MYCTH_53508Help
Entry
MYCTH_53508       CDS       T02231                                 

Definition
glycerol kinase-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYCTH_53508
Enzymes [BR:mtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MYCTH_53508
Exosome [BR:mtm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCTH_53508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(2130206..2130531,2130627..2131627,2131705..2132123)
Genome map
AA seq 581 aa AA seqDB search
MVQAREPNSVRFEDTLIDGGPSLNLDGLLMKPTAATPRRLPDITANLDTHQEAHLPQGIR
ETDEEKRQHWFVGSIDQGTTSSRFLIFNGEGEPVASHQIEFENLYPKSGWHEHDPHVLVS
SVEECIEGAMRKFVDLGYSKSDIRAIGITNQRETTVVWDSVTGEPLHNAIVWPDTRTSAL
VRELKAREGADGLTELCGLPLSTYPSSVKLLWLIQNVDAVKQAYEQGRLAFGTVDSWLIY
RLNGGAKAERPVHVTDSTNASRTMFVNIRTLQYDDKLLAFFGIDKAKVQLPKIVPSSDPE
CFGKVASGPLENVPIAGCLGDQSSALVGQCGFSPGQAKNTYGTGCFLLYNVGTEPVISKY
GLLATVAYDFGRGRKPVYALEGSIAVAGSGVKFLMDNLGFIKNSSEISALAESVPDNGGV
VFVTAFSGLFAPYWIDDAKGTLFGITHHTNKGHIARATLEATCYQTRAILEAMEKDSNHK
LESLAVDGGLSNSDLCMQTQADITGIPVDRPRMRETTALGAAIAAGLATGVWRELEDLKQ
VNRNGRKVFYPQMERAKAEKMFKKWEQAVEMSRGWCQDQDQ
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggttcaagccagggaaccaaattcggtccgcttcgaggacacgctcatagacggcggt
ccaagtctcaacctagatggtctcttgatgaagcccactgccgcaacaccgaggcgactc
ccggacatcacagccaacctcgatacgcaccaggaggcacacctcccgcaggggattcgc
gagacggacgaggagaaaaggcagcactggttcgtcggcagcatcgaccagggcaccacg
tcgtcgcgttttctcatcttcaacggcgagggcgaacccgttgcgagccaccaaatagag
tttgagaatctgtaccccaagtcaggatggcacgaacacgatcctcacgtgcttgtcagc
tcggtcgaggagtgtattgaaggggcgatgcgcaagtttgtcgatctgggctactccaag
tcggacatccgggccatcggcatcaccaaccagcgcgagacgacggtagtgtgggacagc
gtcaccggcgagcccctgcacaatgccatcgtctggccagacacgcggacgagcgccctc
gtgcgcgaactcaaggcgcgcgagggtgccgacggcctgacagagctctgcggtctccca
ttgtcgacgtaccccagcagcgtcaagctcctctggctcatccagaacgttgacgcggtc
aaacaagcctacgagcagggccgtcttgccttcggcaccgtcgactcctggctcatctac
aggctcaacggcggcgcaaaggccgagaggccggtgcacgtcacggacagcaccaacgcc
agtcggaccatgtttgtcaacatccgcaccttgcagtacgacgacaagctcctggctttc
ttcggcatcgacaaggcaaaggtccagctccccaagatcgtgccgtcgtcagatcccgaa
tgctttggcaaggtcgccagcggcccactggagaacgtccccatcgccggctgtttgggc
gaccaatccagcgccctggtcggccagtgcggcttcagtcccgggcaggcgaagaatacg
tacggcacgggatgcttcctcttgtacaacgttggaaccgagcccgtcatctccaaatac
ggcctgctcgctaccgtggcctacgactttggccgtggccgaaagccagtgtacgccctc
gagggtagcatcgccgtcgccggctccggcgtcaagtttctgatggacaacctcggcttc
atcaagaattcgagcgaaatttcggcgctggcagaatcggtgcccgacaacggcggcgtc
gtctttgtcacagccttcagcgggctttttgccccctactggattgacgacgcaaagggg
acactcttcggtattacccaccacacaaacaagggacacattgctcgcgccaccctcgaa
gccacctgttaccagacccgcgctatcttggaggccatggagaaggattcgaatcacaag
ctcgagtcgctcgccgtcgacggcggcctctccaactcggacctgtgcatgcagacccag
gccgacattacgggcatccctgtggaccgtccgcggatgcgcgaaaccacagcgctgggt
gccgccatcgctgcgggcctcgctactggtgtctggagggaactggaagatctcaagcag
gtcaaccggaatgggcgcaaggtcttctacccacagatggagagggccaaggccgagaag
atgttcaagaaatgggagcaggccgtggagatgagcaggggttggtgccaagatcaagat
cagtga

DBGET integrated database retrieval system