KEGG   Myceliophthora thermophila: MYCTH_57502Help
Entry
MYCTH_57502       CDS       T02231                                 

Definition
aldose epimerase-like protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mtm  Myceliophthora thermophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mtm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCTH_57502
   00052 Galactose metabolism
    MYCTH_57502
Enzymes [BR:mtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MYCTH_57502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(2032445..2032839,2032924..2033770))
Genome map
AA seq 413 aa AA seqDB search
MRLLLSLYGAALFLKGALATPPHTPHGESPDEDGKYWIYGEGIAAAFIPYGASITNLIID
DKNGIPRDLVMGFDKASDYPKDKSHPHLGGVPGRYANRIKNSTFEIDGKTYRVTANENPT
RKHPDGLDTLHGGVEGWDWRDFDVVSHTDESITFSIVDPDGKEGFPGEVISYITYTMGNL
TWDAKMVAIATTKKTPIMLSSHTYWNLDGFANDETDTIFDHTLHLPYSGQRIDVDNILIP
TGKILPNPEGSVNDFWSAPKQIGDGFKDPEIHGNCGFDCTGYDNCWLVNRPGPHDWRADG
AYVASLYSAWSGIRLDIYSDQDAFQMYSCNGQDGTFPLKSTQGVDGRNADKRHPHKPAQT
VPQYGCVVLEVEDYIDGINHPEWGRLGKQVFGPGSDPYVLQISHRFSVDTDDA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcttgctctcgctctacggagcagccctgtttctgaagggggcgctggctact
cctccacacaccccgcatggcgagagcccggatgaggatggaaaatactggatctacggc
gagggaatcgcggccgccttcatcccgtacggcgcttccattaccaacctcattattgac
gacaagaatggtatcccccgtgacctcgtgatgggcttcgacaaggccagcgactacccc
aaggataaatcgcacccccaccttggcggcgtccctggccgctatgcgaaccggatcaag
aacagcaccttcgagattgacggcaagacttaccgcgtcacggccaatgagaatcccacc
cgcaagcaccccgacgggctcgacaccctccacggcggcgtggaagggtgggactggcga
gactttgacgtggtctcgcacaccgacgagtccatcaccttctccattgttgaccccgac
ggcaaggaaggcttccccggcgaggtcatctcgtacatcacttacacgatgggcaacttg
acctgggacgccaagatggtggccatcgccacgaccaagaagacgcccatcatgctgagc
agccacacgtactggaacctggacggctttgccaatgacgagaccgacaccatctttgac
cacacactccaccttccgtacagtggccagaggatcgacgtcgacaacattctgattccg
accggcaagatcctgcccaaccccgagggctctgtcaacgacttttggagcgcccccaag
cagatcggcgacggcttcaaagacccggagatccacggcaactgcggcttcgactgcact
ggctacgacaactgctggctcgtcaaccggccgggcccgcacgactggcgcgccgacgga
gcctacgtcgccagcctgtactcggcctggtccggcatcaggctcgacatttactccgac
caggatgccttccagatgtactcttgcaatggccaggacggcacgttcccgctcaagtcg
acccagggcgtcgatgggcgcaacgccgacaagcgccacccccacaaaccagcccagact
gtgccgcagtatggctgcgtcgtcctggaggtggaggactacatcgacgggatcaaccac
cccgagtggggccggctggggaagcaggtatttgggcccgggagcgatccgtacgtgctg
cagattagccaccgcttctcagtagacacggacgacgcatga

DBGET integrated database retrieval system