KEGG   Myceliophthora thermophila: MYCTH_61659Help
Entry
MYCTH_61659       CDS       T02231                                 

Definition
histone acetyltransferase-like protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mtm  Myceliophthora thermophila
Brite
Enzymes [BR:mtm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MYCTH_61659
Transcription machinery [BR:mtm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MYCTH_61659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(437264..437276,437347..437471,437585..438637)
Genome map
AA seq 396 aa AA seqDB search
MKDENGKRKASDEPSSPVASKRVKHDNSAEPEQKPANIPPIPYPEKPAVIEERNGEIEFR
VVNNDNQRESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITY
RPFKGRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKK
QGFTKEITLDKSVWMGYIKDYEGGTIMQCTMLPRIRYLEMGRMLLKQKECVQAKIRAYSK
SHIVHQPPKQWQKHGVSPIDPLSIEAIRASGWSPDMDELARQPRHGPNYNQLLHLLNDLQ
NHPSSWPFLVPVNKDEVLDYYDVIKEPMDLSTMESKLEADQYNTPEDFIRDAKLIFDNCR
KYNNESTPYAKSANKLEKFMWQQIRAIPEWSHLGDS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgagaacgggaagcgcaaggcatcagacgagccgtcgtcgcctgtcgcatct
aagcgcgtcaaacacgacaactcggccgaaccagagcagaaacccgccaacatcccgcca
attccgtaccctgaaaagcccgcggttatcgaagagcgcaatggagagatcgagttccga
gtggtcaacaatgacaaccagcgcgagagtctcatcatcctcactggcctcaaatgcatc
tttcaaaagcagctaccgaaaatgcctaaggattacattgcgcgcttggtctacgaccgc
acacatttgtccatcgccatcgtgaagaagccgcttgaggtggtcggcggcatcacgtac
cggccgttcaaagggcgcaaatttgccgagattgtgttctgcgccatctcgtcggaccag
caggtcaagggttacggcgcccacctcatgtcgcacctaaaagactacgttaaggcgacg
tcggacgtgatgcacttcttgacgtatgccgacaactacgcgatcggctacttcaagaag
cagggcttcaccaaggagatcacgctcgacaagtccgtctggatgggctatatcaaagat
tacgaaggcggcaccatcatgcagtgcaccatgctcccgcggatccgctacctcgagatg
ggccgcatgctgctcaagcagaaggagtgcgttcaggccaagatccgggcctattccaaa
tcccacatcgtccaccagccgcccaagcagtggcagaagcacggcgtctccccgatcgac
ccgctctcgatcgaggcgatccgcgcctcgggctggtcccccgacatggacgagctggcg
cgccagccgcgccacgggcccaactacaaccagctgctccacctcctcaacgacctgcag
aaccacccgtcgagctggcccttcctggtccccgtcaacaaggacgaggtgctcgactac
tacgacgtcatcaaggagcccatggacctgtccaccatggagtccaagctcgaggcggac
cagtacaacacgcccgaggacttcatccgcgacgccaagctcatctttgacaactgccgc
aagtacaacaacgagtcgacgccctacgccaagtcggccaacaagctcgagaagttcatg
tggcagcagatcagggccatcccggaatggtcgcacctcggggactcttag

DBGET integrated database retrieval system